Property Summary

NCBI Gene PubMed Count 235
PubMed Score 440.31
PubTator Score 377.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

Disease log2 FC p
active ulcerative colitis -1.012 3.5e-02
adrenocortical adenoma -1.201 1.2e-02
adrenocortical carcinoma -1.470 1.9e-02
astrocytoma 1.500 6.0e-10
Astrocytoma, Pilocytic 1.100 2.8e-03
breast carcinoma -1.500 1.6e-04
cystic fibrosis 1.397 9.4e-05
Down syndrome 1.100 1.1e-02
ductal carcinoma in situ -1.200 1.7e-02
ependymoma 1.200 1.4e-03
gastric cancer -1.300 2.0e-02
glioblastoma 2.300 3.0e-02
group 4 medulloblastoma -1.800 7.5e-07
hepatocellular carcinoma -2.000 7.5e-04
interstitial cystitis -1.300 1.2e-03
invasive ductal carcinoma -2.000 2.2e-02
lung adenocarcinoma -1.100 1.6e-07
lung cancer 2.200 1.2e-03
lung carcinoma -1.100 1.7e-06
malignant mesothelioma -3.700 1.5e-08
medulloblastoma, large-cell -1.300 4.5e-02
non-inflammatory breast cancer -1.400 8.8e-03
non-small cell lung cancer -1.272 4.7e-08
oligodendroglioma 1.800 3.6e-02
osteosarcoma 1.950 1.3e-02
ovarian cancer -3.000 1.1e-08
pancreatic cancer 1.900 1.0e-06
pancreatic ductal adenocarcinoma liver m... -1.773 4.4e-02
pituitary cancer -3.100 1.5e-05
psoriasis 1.600 5.5e-05
Rheumatoid arthritis 2.600 1.5e-02

Gene RIF (211)

AA Sequence

MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMN      1 - 70
GCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALT     71 - 140
AEAACVPADDRILCR                                                           141 - 155
//

Text Mined References (236)

PMID Year Title