Property Summary

NCBI Gene PubMed Count 223
Grant Count 229
R01 Count 147
Funding $27,435,533.67
PubMed Score 414.31
PubTator Score 377.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

Disease log2 FC p
Rheumatoid Arthritis 2.600 0.015
gastric cancer -1.300 0.020
hepatocellular carcinoma -2.000 0.001
malignant mesothelioma -3.700 0.000
oligodendroglioma 1.800 0.036
psoriasis 1.600 0.000
astrocytoma 1.500 0.000
glioblastoma 2.300 0.030
osteosarcoma 1.950 0.013
posterior fossa group A ependymoma 1.900 0.000
cystic fibrosis 1.397 0.000
medulloblastoma, large-cell -1.300 0.045
adrenocortical adenoma -1.201 0.012
adrenocortical carcinoma -1.470 0.019
pancreatic ductal adenocarcinoma liver m... -1.773 0.044
non-small cell lung cancer -1.272 0.000
lung cancer 2.200 0.001
active ulcerative colitis -1.012 0.035
pancreatic cancer 2.000 0.050
breast carcinoma -1.500 0.000
interstitial cystitis -1.500 0.001
lung adenocarcinoma -1.800 0.000
group 4 medulloblastoma -1.800 0.000
pilocytic astrocytoma 1.100 0.003
non-inflammatory breast cancer -1.400 0.009
lung carcinoma -1.100 0.000
ductal carcinoma in situ -1.200 0.017
invasive ductal carcinoma -2.000 0.022
ovarian cancer -3.000 0.000
pituitary cancer -3.100 0.000
Down syndrome 1.100 0.011

Synonym

Gene

ID1

PANTHER Protein Class (1)

Gene RIF (200)

PMID Text
26858249 Simultaneous high expression of ID1 and c-Jun or c-Fos was correlated with poor survival in esophageal squamous cell carcinoma patients.
26797271 Therefore, we identified a tumorigenic role of Id-1 in OS and suggested a potential therapeutic target for OS patients.
26577912 Peritoneal VEGF-A expression is regulated by TGF-beta1 through an ID1 pathway in women with endometriosis
26191235 ID1 overexpression may be associated with higher risk karyotype classification and act as an independent risk factor in young non-M3 acute myeloid leukemia patients.
26072160 Four more genes (BMP4, BMPR1B, SMAD1 and SMAD4) of the ID1 pathway were investigated and only one (BMPR1B) shows the same down regulation
25938540 these findings provide in vivo genetic evidence of Id1 functions as an oncogene in breast cancer
25924227 Advanced melanoma patients, relative to healthy controls, express much higher levels of ID1 in myeloid peripheral blood cells.
25778840 Inhibitor of differentiation 4 (ID4) acts as an inhibitor of ID-1, -2 and -3 and promotes basic helix loop helix (bHLH) E47 DNA binding and transcriptional activity.
25623217 Overexpression of ID1 is associated with colorectal neoplasia.
25549282 Downregulation of ID1 by gene silencing can lead to acceleration of TGF-beta1-induced hESC differentiation into ECs and inhibition of proliferation and migration of ECs.
More...

AA Sequence

MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMN      1 - 70
GCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALT     71 - 140
AEAACVPADDRILCR                                                           141 - 155
//

Text Mined References (224)

PMID Year Title
26858249 2016 Inhibitor of Differentiation/DNA Binding 1 (ID1) Inhibits Etoposide-induced Apoptosis in a c-Jun/c-Fos-dependent Manner.
26797271 2016 Id-1 promotes osteosarcoma cell growth and inhibits cell apoptosis via PI3K/AKT signaling pathway.
26577912 2015 Peritoneal VEGF-A expression is regulated by TGF-?1 through an ID1 pathway in women with endometriosis.
26191235 2015 Clinical significance of up-regulated ID1 expression in Chinese de novo acute myeloid leukemia.
26072160 2015 ANXA1Ac???? peptide reduces ID1 expression in cervical carcinoma cultures.
25938540 2015 Overexpression of Id1 in transgenic mice promotes mammary basal stem cell activity and breast tumorigenesis.
25924227 2015 Id1 suppresses anti-tumour immune responses and promotes tumour progression by impairing myeloid cell maturation.
25778840 2015 Inhibitor of differentiation 4 (ID4) acts as an inhibitor of ID-1, -2 and -3 and promotes basic helix loop helix (bHLH) E47 DNA binding and transcriptional activity.
25623217 2015 Id1 Deficiency Protects against Tumor Formation in Apc(Min/+) Mice but Not in a Mouse Model of Colitis-Associated Colon Cancer.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
More...