Property Summary

NCBI Gene PubMed Count 17
Grant Count 10
R01 Count 8
Funding $570,589.67
PubMed Score 30.55
PubTator Score 13.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 2.100 0.000
psoriasis -1.100 0.005
osteosarcoma -3.275 0.000
medulloblastoma, large-cell 1.400 0.000
Atopic dermatitis 1.100 0.000
non-small cell lung cancer 1.036 0.000
lung cancer 2.200 0.001
colon cancer 1.500 0.001
Breast cancer 1.200 0.000

Gene RIF (8)

PMID Text
27080313 Data indicate that a missense mutation in cyclin F (CCNF) in a large Amyotrophic lateral sclerosis (ALS) and frontotemporal dementia (FTD) family.
26818844 CDC6 and Cyclin F interact through defined sequence motifs that promote CDC6 ubiquitylation and degradation.
25980818 The SCYL1- BP1 affects the cell cycle through increasing steady state levels of Cyclin F and RRM2 proteins, thus constituting a dual regulatory circuit.
25557911 Cyclin F suppresses B-Myb activity to promote cell cycle checkpoint control.
23182110 Cyclin F controls genome stability through ubiquitin-mediated proteolysis. (Review)
22632967 After DNA damage, cyclin F is downregulated in an ATR-dependent manner to allow accumulation of RRM2. Defective elimination of cyclin F delays DNA repair and sensitizes cells to DNA damage, a phenotype that is reverted by expressing a nondegradable RRM2 mutant.
20596027 SCF(Cyclin F)-mediated degradation of CP110 is required for the fidelity of mitosis and genome integrity
12122006 degradation during G2-M by mechanisms fundamentally different from other cyclins

AA Sequence

MGSGGVVHCRCAKCFCYPTKRRIRRRPRNLTILSLPEDVLFHILKWLSVEDILAVRAVHSQLKDLVDNHA      1 - 70
SVWACASFQELWPSPGNLKLFERAAEKGNFEAAVKLGIAYLYNEGLSVSDEARAEVNGLKASRFFSLAER     71 - 140
LNVGAAPFIWLFIRPPWSVSGSCCKAVVHESLRAECQLQRTHKASILHCLGRVLSLFEDEEKQQQAHDLF    141 - 210
EEAAHQGCLTSSYLLWESDRRTDVSDPGRCLHSFRKLRDYAAKGCWEAQLSLAKACANANQLGLEVRASS    211 - 280
EIVCQLFQASQAVSKQQVFSVQKGLNDTMRYILIDWLVEVATMKDFTSLCLHLTVECVDRYLRRRLVPRY    281 - 350
RLQLLGIACMVICTRFISKEILTIREAVWLTDNTYKYEDLVRMMGEIVSALEGKIRVPTVVDYKEVLLTL    351 - 420
VPVELRTQHLCSFLCELSLLHTSLSAYAPARLAAAALLLARLTHGQTQPWTTQLWDLTGFSYEDLIPCVL    421 - 490
SLHKKCFHDDAPKDYRQVSLTAVKQRFEDKRYGEISQEEVLSYSQLCAALGVTQDSPDPPTFLSTGEIHA    491 - 560
FLSSPSGRRTKRKRENSLQEDRGSFVTTPTAELSSQEETLLGSFLDWSLDCCSGYEGDQESEGEKEGDVT    561 - 630
APSGILDVTVVYLNPEQHCCQESSDEEACPEDKGPQDPQALALDTQIPATPGPKPLVRTSREPGKDVTTS    631 - 700
GYSSVSTASPTSSVDGGLGALPQPTSVLSLDSDSHTQPCHHQARKSCLQCRPPSPPESSVPQQQVKRINL    701 - 770
CIHSEEEDMNLGLVRL                                                          771 - 786
//

Text Mined References (19)

PMID Year Title
27080313 2016 CCNF mutations in amyotrophic lateral sclerosis and frontotemporal dementia.
26818844 2016 SCF(Cyclin F)-dependent degradation of CDC6 suppresses DNA re-replication.
25980818 2016 SCYL1-BP1 affects cell cycle arrest in human hepatocellular carcinoma cells via Cyclin F and RRM2.
25557911 2015 Cyclin F suppresses B-Myb activity to promote cell cycle checkpoint control.
23182110 2013 A cyclin without cyclin-dependent kinases: cyclin F controls genome stability through ubiquitin-mediated proteolysis.
22632967 2012 Cyclin F-mediated degradation of ribonucleotide reductase M2 controls genome integrity and DNA repair.
22441691 2012 Neurl4, a novel daughter centriole protein, prevents formation of ectopic microtubule organizing centres.
20596027 2010 SCF(Cyclin F) controls centrosome homeostasis and mitotic fidelity through CP110 degradation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
More...