Property Summary

NCBI Gene PubMed Count 17
PubMed Score 30.55
PubTator Score 13.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.21633014766408E-19
Breast cancer 3099 3.84767854021017E-19
osteosarcoma 7933 1.82072721151079E-8
malignant mesothelioma 3163 3.73375204360635E-6
medulloblastoma, large-cell 6234 7.58555979872232E-5
Atopic dermatitis 944 3.63879541340805E-4
lung cancer 4473 9.86390516339043E-4
colon cancer 1475 0.00116171367638368
psoriasis 6685 0.0051127372254784
Disease Target Count Z-score Confidence
Necrotizing fasciitis 9 5.307 2.7

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 2.100 0.000
psoriasis -1.100 0.005
osteosarcoma -3.275 0.000
medulloblastoma, large-cell 1.400 0.000
Atopic dermatitis 1.100 0.000
non-small cell lung cancer 1.036 0.000
lung cancer 2.200 0.001
colon cancer 1.500 0.001
Breast cancer 1.200 0.000

Synonym

Accession P41002 B2R8H3 Q96EG9
Symbols FBX1
FBXO1

Gene

  Ortholog (8)

Gene RIF (8)

PMID Text
27080313 Data indicate that a missense mutation in cyclin F (CCNF) in a large Amyotrophic lateral sclerosis (ALS) and frontotemporal dementia (FTD) family.
26818844 CDC6 and Cyclin F interact through defined sequence motifs that promote CDC6 ubiquitylation and degradation.
25980818 The SCYL1- BP1 affects the cell cycle through increasing steady state levels of Cyclin F and RRM2 proteins, thus constituting a dual regulatory circuit.
25557911 Cyclin F suppresses B-Myb activity to promote cell cycle checkpoint control.
23182110 Cyclin F controls genome stability through ubiquitin-mediated proteolysis. (Review)
22632967 After DNA damage, cyclin F is downregulated in an ATR-dependent manner to allow accumulation of RRM2. Defective elimination of cyclin F delays DNA repair and sensitizes cells to DNA damage, a phenotype that is reverted by expressing a nondegradable RRM2 mutant.
20596027 SCF(Cyclin F)-mediated degradation of CP110 is required for the fidelity of mitosis and genome integrity
12122006 degradation during G2-M by mechanisms fundamentally different from other cyclins

AA Sequence

MGSGGVVHCRCAKCFCYPTKRRIRRRPRNLTILSLPEDVLFHILKWLSVEDILAVRAVHSQLKDLVDNHA      1 - 70
SVWACASFQELWPSPGNLKLFERAAEKGNFEAAVKLGIAYLYNEGLSVSDEARAEVNGLKASRFFSLAER     71 - 140
LNVGAAPFIWLFIRPPWSVSGSCCKAVVHESLRAECQLQRTHKASILHCLGRVLSLFEDEEKQQQAHDLF    141 - 210
EEAAHQGCLTSSYLLWESDRRTDVSDPGRCLHSFRKLRDYAAKGCWEAQLSLAKACANANQLGLEVRASS    211 - 280
EIVCQLFQASQAVSKQQVFSVQKGLNDTMRYILIDWLVEVATMKDFTSLCLHLTVECVDRYLRRRLVPRY    281 - 350
RLQLLGIACMVICTRFISKEILTIREAVWLTDNTYKYEDLVRMMGEIVSALEGKIRVPTVVDYKEVLLTL    351 - 420
VPVELRTQHLCSFLCELSLLHTSLSAYAPARLAAAALLLARLTHGQTQPWTTQLWDLTGFSYEDLIPCVL    421 - 490
SLHKKCFHDDAPKDYRQVSLTAVKQRFEDKRYGEISQEEVLSYSQLCAALGVTQDSPDPPTFLSTGEIHA    491 - 560
FLSSPSGRRTKRKRENSLQEDRGSFVTTPTAELSSQEETLLGSFLDWSLDCCSGYEGDQESEGEKEGDVT    561 - 630
APSGILDVTVVYLNPEQHCCQESSDEEACPEDKGPQDPQALALDTQIPATPGPKPLVRTSREPGKDVTTS    631 - 700
GYSSVSTASPTSSVDGGLGALPQPTSVLSLDSDSHTQPCHHQARKSCLQCRPPSPPESSVPQQQVKRINL    701 - 770
CIHSEEEDMNLGLVRL                                                          771 - 786
//

Text Mined References (19)

PMID Year Title
27080313 2016 CCNF mutations in amyotrophic lateral sclerosis and frontotemporal dementia.
26818844 2016 SCF(Cyclin F)-dependent degradation of CDC6 suppresses DNA re-replication.
25980818 2016 SCYL1-BP1 affects cell cycle arrest in human hepatocellular carcinoma cells via Cyclin F and RRM2.
25557911 2015 Cyclin F suppresses B-Myb activity to promote cell cycle checkpoint control.
23182110 2013 A cyclin without cyclin-dependent kinases: cyclin F controls genome stability through ubiquitin-mediated proteolysis.
22632967 2012 Cyclin F-mediated degradation of ribonucleotide reductase M2 controls genome integrity and DNA repair.
22441691 2012 Neurl4, a novel daughter centriole protein, prevents formation of ectopic microtubule organizing centres.
20596027 2010 SCF(Cyclin F) controls centrosome homeostasis and mitotic fidelity through CP110 degradation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
More...