Property Summary

NCBI Gene PubMed Count 68
PubMed Score 948.20
PubTator Score 205.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
ulcerative colitis 2087 2.50626604854802E-6
osteosarcoma 7933 5.38264191583084E-5
colon cancer 1475 4.67033284785775E-4
ovarian cancer 8492 0.00103845545691454
Multiple myeloma 1328 0.00139878413517234
oligodendroglioma 2849 0.00145729609532553
astrocytoma 1493 0.00308641095292742
ependymoma 2514 0.00441976509306307
Rheumatoid Arthritis 1171 0.0115810468546209
aldosterone-producing adenoma 664 0.0180922896795666
pancreatic ductal adenocarcinoma liver metastasis 1795 0.019489404739811

Expression

  Differential Expression (11)

Disease log2 FC p
Rheumatoid Arthritis 1.500 0.012
Multiple myeloma 1.289 0.001
ependymoma 1.300 0.004
oligodendroglioma 1.600 0.001
osteosarcoma 1.685 0.000
astrocytoma 1.100 0.003
pancreatic ductal adenocarcinoma liver m... -1.712 0.019
colon cancer -1.300 0.000
aldosterone-producing adenoma -1.108 0.018
ulcerative colitis -1.100 0.000
ovarian cancer 1.500 0.001

Synonym

Accession P40939 B2R7L4 B4DYP2 Q16679 Q53T69 Q53TA2 Q96GT7 Q9UQC5
Symbols GBP
ECHA
HADH
LCEH
MTPA
LCHAD
TP-ALPHA

Gene

PANTHER Protein Class (2)

  Ortholog (17)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
Zebrafish OMA EggNOG
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid

Gene RIF (38)

PMID Text
26367179 findings suggest an auxiliary role for HADHA in miRNA biogenesis and help in better understanding of molecular mechanisms underlying RNAi pathway
26109258 Exposure to bezafibrate (400 muM for 48 h) increased the abundance of HADHA and HADHB mRNAs.
25816318 nonstructural protein 5 (NS5) interacted with hydroxyacyl-CoA dehydrogenase alpha and beta subunits, two components of the mitochondrial trifunctional protein (MTP) involved in LCFA beta-oxidation
25673715 Mitochondrial Trifunctional-Protein depletion during hepatitis c virus infection rendered cells less responsive to alpha interferon treatment by impairing IFN-stimulated gene expression.
25478839 Crystal structures of human mitochondrial 3-ketoacyl-CoA thiolase (hT1) in the apo form and in complex with CoA have been determined at 2.0 A resolution. The structures confirm the tetrameric quaternary structure of this degradative thiolase.
24105666 revealed a novel G/A allelic change in the intronic region [chromosomal position 26417674; 20 bp adjacent to an already published SNP (rs151243950)] for one among the three acute fatty liver of pregnancy patients
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of trifunctional protein, alpha subunit (HADHA) expression by HIV-1 Vpr in Vpr transduced macrophages
23253803 Free fatty acids might affect the expression of mitochondrial beta-oxidation enzyme of LCHAD in trophoblast cells.
23152787 mitochondrial alphaTFP exhibits both in vitro and in vivo MLCL AT activity linking an enzyme of mitochondrial beta-oxidation to Cardiolipin remodeling.
22746996 these findings lend support to the hypothesis that mutations in the HADHA gene may be directly associated with and potentially causative of Maternal floor infarction/massive perivillous fibrin deposition
More...

AA Sequence

MVACRAIGILSRFSAFRILRSRGYICRNFTGSSALLTRTHINYGVKGDVAVVRINSPNSKVNTLSKELHS      1 - 70
EFSEVMNEIWASDQIRSAVLISSKPGCFIAGADINMLAACKTLQEVTQLSQEAQRIVEKLEKSTKPIVAA     71 - 140
INGSCLGGGLEVAISCQYRIATKDRKTVLGTPEVLLGALPGAGGTQRLPKMVGVPAALDMMLTGRSIRAD    141 - 210
RAKKMGLVDQLVEPLGPGLKPPEERTIEYLEEVAITFAKGLADKKISPKRDKGLVEKLTAYAMTIPFVRQ    211 - 280
QVYKKVEEKVRKQTKGLYPAPLKIIDVVKTGIEQGSDAGYLCESQKFGELVMTKESKALMGLYHGQVLCK    281 - 350
KNKFGAPQKDVKHLAILGAGLMGAGIAQVSVDKGLKTILKDATLTALDRGQQQVFKGLNDKVKKKALTSF    351 - 420
ERDSIFSNLTGQLDYQGFEKADMVIEAVFEDLSLKHRVLKEVEAVIPDHCIFASNTSALPISEIAAVSKR    421 - 490
PEKVIGMHYFSPVDKMQLLEIITTEKTSKDTSASAVAVGLKQGKVIIVVKDGPGFYTTRCLAPMMSEVIR    491 - 560
ILQEGVDPKKLDSLTTSFGFPVGAATLVDEVGVDVAKHVAEDLGKVFGERFGGGNPELLTQMVSKGFLGR    561 - 630
KSGKGFYIYQEGVKRKDLNSDMDSILASLKLPPKSEVSSDEDIQFRLVTRFVNEAVMCLQEGILATPAEG    631 - 700
DIGAVFGLGFPPCLGGPFRFVDLYGAQKIVDRLKKYEAAYGKQFTPCQLLADHANSPNKKFYQ           701 - 763
//

Text Mined References (75)

PMID Year Title
26367179 2015 Association of HADHA with human RNA silencing machinery.
26109258 2016 Mitochondrial trifunctional protein deficiency in human cultured fibroblasts: effects of bezafibrate.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25816318 2015 Japanese encephalitis virus nonstructural protein NS5 interacts with mitochondrial trifunctional protein and impairs fatty acid ?-oxidation.
25673715 2015 Hepatitis C virus attenuates mitochondrial lipid ?-oxidation by downregulating mitochondrial trifunctional-protein expression.
25478839 2014 The crystal structure of human mitochondrial 3-ketoacyl-CoA thiolase (T1): insight into the reaction mechanism of its thiolase and thioesterase activities.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24105666 2014 Absence of G1528C mutation in long-chain 3-hydroxyacyl-CoA dehydrogenase in four Indian patients with pregnancy-related liver disease.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23253803 2012 [Effects of expression of mitochondria long-chain fatty acid oxidative enzyme with different chain lengths of free fatty acids in trophoblast cells].
More...