Property Summary

NCBI Gene PubMed Count 70
PubMed Score 989.43
PubTator Score 205.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (11)

Disease log2 FC p
aldosterone-producing adenoma -1.108 1.8e-02
astrocytoma 1.100 3.1e-03
colon cancer -1.300 4.7e-04
ependymoma 1.300 4.4e-03
Multiple myeloma 1.094 1.8e-03
oligodendroglioma 1.600 1.5e-03
osteosarcoma 1.685 5.4e-05
ovarian cancer -1.100 4.2e-04
pancreatic ductal adenocarcinoma liver m... -1.712 1.9e-02
Rheumatoid arthritis 1.500 1.2e-02
ulcerative colitis -1.100 2.5e-06

Gene RIF (41)

AA Sequence

MVACRAIGILSRFSAFRILRSRGYICRNFTGSSALLTRTHINYGVKGDVAVVRINSPNSKVNTLSKELHS      1 - 70
EFSEVMNEIWASDQIRSAVLISSKPGCFIAGADINMLAACKTLQEVTQLSQEAQRIVEKLEKSTKPIVAA     71 - 140
INGSCLGGGLEVAISCQYRIATKDRKTVLGTPEVLLGALPGAGGTQRLPKMVGVPAALDMMLTGRSIRAD    141 - 210
RAKKMGLVDQLVEPLGPGLKPPEERTIEYLEEVAITFAKGLADKKISPKRDKGLVEKLTAYAMTIPFVRQ    211 - 280
QVYKKVEEKVRKQTKGLYPAPLKIIDVVKTGIEQGSDAGYLCESQKFGELVMTKESKALMGLYHGQVLCK    281 - 350
KNKFGAPQKDVKHLAILGAGLMGAGIAQVSVDKGLKTILKDATLTALDRGQQQVFKGLNDKVKKKALTSF    351 - 420
ERDSIFSNLTGQLDYQGFEKADMVIEAVFEDLSLKHRVLKEVEAVIPDHCIFASNTSALPISEIAAVSKR    421 - 490
PEKVIGMHYFSPVDKMQLLEIITTEKTSKDTSASAVAVGLKQGKVIIVVKDGPGFYTTRCLAPMMSEVIR    491 - 560
ILQEGVDPKKLDSLTTSFGFPVGAATLVDEVGVDVAKHVAEDLGKVFGERFGGGNPELLTQMVSKGFLGR    561 - 630
KSGKGFYIYQEGVKRKDLNSDMDSILASLKLPPKSEVSSDEDIQFRLVTRFVNEAVMCLQEGILATPAEG    631 - 700
DIGAVFGLGFPPCLGGPFRFVDLYGAQKIVDRLKKYEAAYGKQFTPCQLLADHANSPNKKFYQ           701 - 763
//

Text Mined References (77)

PMID Year Title