Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00
PubTator Score 2.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
medulloblastoma 720 7.7e-03
Disease Target Count Z-score Confidence
Feingold syndrome 14 4.057 2.0
Neuroblastoma 80 4.032 2.0

Gene RIF (3)

AA Sequence

MQHPPCEPGNCLSLKEKKITEGSGGVCWGGETDASNPAPALTACCAAEREANVEQGLAGRLLLCNYERRV      1 - 70
VRRCKIAGRGRAPLGTRPLDVSSFKLKEEGRPPCLKINK                                    71 - 109
//

Text Mined References (12)

PMID Year Title