Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00
PubTator Score 2.48

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (2)

PMID Text
25880909 functional interplay between MYCN, NCYM, and OCT4 contributes to aggressiveness of MYCN-amplified human neuroblastomas.
24391509 these results suggest that GSK3b inhibition by NCYM stabilizes the MYCN protein both in vitro and in vivo.

AA Sequence

MQHPPCEPGNCLSLKEKKITEGSGGVCWGGETDASNPAPALTACCAAEREANVEQGLAGRLLLCNYERRV      1 - 70
VRRCKIAGRGRAPLGTRPLDVSSFKLKEEGRPPCLKINK                                    71 - 109
//

Text Mined References (11)

PMID Year Title
26549029 2016 CTCF cooperates with noncoding RNA MYCNOS to promote neuroblastoma progression through facilitating MYCN expression.
26156430 2015 MYCNOS functions as an antisense RNA regulating MYCN.
25896758 2015 NCYM promotes calpain-mediated Myc-nick production in human MYCN-amplified neuroblastoma cells.
25880909 2015 Functional interplay between MYCN, NCYM, and OCT4 promotes aggressiveness of human neuroblastomas.
24391509 2014 NCYM, a Cis-antisense gene of MYCN, encodes a de novo evolved protein that inhibits GSK3? resulting in the stabilization of MYCN in human neuroblastomas.
19615087 2009 Regulation of MYCN expression in human neuroblastoma cells.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
12880964 2003 Genes co-amplified with MYCN in neuroblastoma: silent passengers or co-determinants of phenotype?
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
1695323 1990 N-myc mRNA forms an RNA-RNA duplex with endogenous antisense transcripts.
More...