Property Summary

NCBI Gene PubMed Count 16
Grant Count 44
R01 Count 19
Funding $13,965,258.42
PubMed Score 108.71
PubTator Score 21.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
cutaneous lupus erythematosus 1.900 0.005
osteosarcoma -3.073 0.000
tuberculosis and treatment for 6 months -2.000 0.001
interstitial cystitis 1.300 0.050
primary Sjogren syndrome 1.500 0.002
lung carcinoma -2.500 0.000
acute myeloid leukemia 4.000 0.030

Gene RIF (10)

PMID Text
26642704 CD96 and CD123 are expressed in bone marrow cells of patients with myelodysplastic syndromes
24751333 In the present study we analyzed the expression of four cell surface antigens relevant to human hematopoiesis-CD90, CD96, CD117, and CD123-in bone marrow from pediatric acute myeloid leukemia patients and normal control subjects.
23272144 down-regulation of CD96 is an important aspect of HIV-1 pathogenesis and differential expression is related to cell effector functions and HIV-1 disease course.
22879978 CD96 could serve as a target structure for effector cell-mediated lysis.
21729528 The positive expression of CD96 on bone marrow hematopoietic stem cells in patients with acute leukemia may be associated with primary drug resistance, relapse and progression.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19056733 CD96-driven adhesion to CD155 may be crucial in developmental processes
17847009 Observational study of genotype prevalence. (HuGE Navigator)
17576927 CD96 is a cell surface marker present on many acute myeloid leukemia leukemic stem cells
15034010 CD96 promotes natural killer (NK) cell adhesion to target cells expressing the poliovirus receptor (PVR), stimulates cytotoxicity of activated NK cells, and mediates acquisition of PVR from target cells.

AA Sequence

MEKKWKYCAVYYIIQIHFVKGVWEKTVNTEENVYATLGSDVNLTCQTQTVGFFVQMQWSKVTNKIDLIAV      1 - 70
YHPQYGFYCAYGRPCESLVTFTETPENGSKWTLHLRNMSCSVSGRYECMLVLYPEGIQTKIYNLLIQTHV     71 - 140
TADEWNSNHTIEIEINQTLEIPCFQNSSSKISSEFTYAWSVENSSTDSWVLLSKGIKEDNGTQETLISQN    141 - 210
HLISNSTLLKDRVKLGTDYRLHLSPVQIFDDGRKFSCHIRVGPNKILRSSTTVKVFAKPEIPVIVENNST    211 - 280
DVLVERRFTCLLKNVFPKANITWFIDGSFLHDEKEGIYITNEERKGKDGFLELKSVLTRVHSNKPAQSDN    281 - 350
LTIWCMALSPVPGNKVWNISSEKITFLLGSEISSTDPPLSVTESTLDTQPSPASSVSPARYPATSSVTLV    351 - 420
DVSALRPNTTPQPSNSSMTTRGFNYPWTSSGTDTKKSVSRIPSETYSSSPSGAGSTLHDNVFTSTARAFS    421 - 490
EVPTTANGSTKTNHVHITGIVVNKPKDGMSWPVIVAALLFCCMILFGLGVRKWCQYQKEIMERPPPFKPP    491 - 560
PPPIKYTCIQEPNESDLPYHEMETL                                                 561 - 585
//

Publication (17)

PMID Year Title
26642704 2015 Expressions of CD96 and CD123 in Bone Marrow Cells of Patients with Myelodysplastic Syndromes.
24751333 2014 Expression of CD90, CD96, CD117, and CD123 on different hematopoietic cell populations from pediatric patients with acute myeloid leukemia.
23272144 2012 Differential expression of CD96 surface molecule represents CD8? T cells with dissimilar effector function during HIV-1 infection.
22879978 2012 Enhanced ADCC activity of affinity maturated and Fc-engineered mini-antibodies directed against the AML stem cell antigen CD96.
21729528 2011 [CD96 expression on bone marrow mononuclear cells in 91 patients with acute leukemia].
21685187 2011 Genome-wide association study of smoking behaviours in patients with COPD.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19056733 2009 CD96 interaction with CD155 via its first Ig-like domain is modulated by alternative splicing or mutations in distal Ig-like domains.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...