Property Summary

NCBI Gene PubMed Count 38
PubMed Score 98.43
PubTator Score 26.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Expression

Synonym

Accession P39023 B2RDV9 Q15548 Q5I0G0
Symbols L3
ASC-1
TARBP-B

Gene

PDB

4UG0   4V6X   5AJ0  

  Ortholog (11)

Species Source
Macaque EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (11)

PMID Text
25473889 rpL3 participates in the cell response to chemotherapy acting as a critical regulator of cell cycle, apoptosis and DNA repair, by modulating p21 expression
24690621 Tandem affinity purification and mass spectrometry analysis identify ribosomal protein L3 (RPL3; HIV-1 TAR RNA-binding protein B), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23255119 The rpL3 is able to modulate the protein amounts of p21 through a novel pathway independent from p53 involving Sp1 and NPM.
23125841 Tandem affinity purification and mass spectrometry analysis identify ribosomal protein L3 (RPL3; HIV-1 TAR RNA-binding protein B), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22944692 Tandem affinity purification and mass spectrometry analysis identify ribosomal protein L3 (RPL3; HIV-1 TAR RNA-binding protein B), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22174317 Tandem affinity purification and mass spectrometry analysis identify ribosomal protein L3 (RPL3; HIV-1 TAR RNA-binding protein B), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21705779 NPM and KHSRP are two newly identified proteins involved in the regulation of rpL3 gene expression via alternative pre-mRNA splicing.
20100605 working model in which rpL3 recruits hnRNP H1 and, through cooperation with other splicing factors, promotes selection of the alternative splice site
19460752 Knockdown of ribosomal protein L3 (RPL3) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
16364039 Involved in progression and regulation of telomerase
More...

AA Sequence

MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNKK      1 - 70
EVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYKNWHKSKKKAFTKYCKKWQDE     71 - 140
DGKKQLEKDFSSMKKYCQVIRVIAHTQMRLLPLRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQV    141 - 210
FGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEI    211 - 280
NKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKS    281 - 350
LLVQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLKKDRIAKEEGA                     351 - 403
//

Text Mined References (52)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25854864 2015 Interaction between human BAP31 and respiratory syncytial virus small hydrophobic (SH) protein.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25473889 2014 Human rpL3 plays a crucial role in cell response to nucleolar stress induced by 5-FU and L-OHP.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23349634 2013 A newly uncovered group of distantly related lysine methyltransferases preferentially interact with molecular chaperones to regulate their activity.
23255119 2013 Human rpL3 induces G?/S arrest or apoptosis by modulating p21 (waf1/cip1) levels in a p53-independent manner.
More...