Property Summary

NCBI Gene PubMed Count 50
PubMed Score 210.73
PubTator Score 53.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Richieri Costa Pereira syndrome 1 0.0 0.0

Expression

  Differential Expression (10)

Disease log2 FC p
adrenocortical carcinoma -1.185 3.5e-06
astrocytoma 1.100 7.8e-03
diabetes mellitus -1.500 4.9e-03
glioblastoma 1.400 5.5e-04
group 3 medulloblastoma 1.200 4.9e-05
invasive ductal carcinoma 1.100 2.3e-03
lung cancer 1.200 3.7e-03
medulloblastoma, large-cell 1.200 1.3e-05
ovarian cancer 1.700 8.6e-04
psoriasis 1.100 9.2e-04

Protein-protein Interaction (2)

Gene RIF (18)

AA Sequence

MATTATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIK      1 - 70
QIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHAC     71 - 140
IGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPP    141 - 210
ATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQA    211 - 280
VIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLII    281 - 350
NYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI             351 - 411
//

Text Mined References (76)

PMID Year Title