Property Summary

NCBI Gene PubMed Count 42
Grant Count 31
R01 Count 8
Funding $7,545,517.28
PubMed Score 176.45
PubTator Score 53.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis 1.100 0.001
astrocytoma 1.100 0.008
glioblastoma 1.400 0.001
medulloblastoma, large-cell 1.200 0.000
adrenocortical carcinoma -1.185 0.000
lung cancer 1.200 0.004
diabetes mellitus -1.500 0.005
group 3 medulloblastoma 1.200 0.000
invasive ductal carcinoma 1.100 0.002
ovarian cancer 1.700 0.001

Gene RIF (18)

PMID Text
26773380 Host eIF4AIII RNA helicase is required for efficient human cytomegalovirus replication.
24360810 EIF4A3 is a gene involved in RNA metabolism, plays a role in mandible, laryngeal, and limb morphogenesis. Richieri-Costa-Pereira syndrome is caused by mutations in EIF4A3.
24218557 The binding mode of CWC22 to eIF4AIII reveals a facet of how MIF4G domains use their versatile structural frameworks to activate or inhibit DEAD-box proteins.
23125841 Tandem affinity purification and mass spectrometry analysis identify eukaryotic translation initiation factor 4A3 (EIF4A3), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify eukaryotic translation initiation factor 4A3 (EIF4A3), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify eukaryotic translation initiation factor 4A3 (EIF4A3), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify eukaryotic translation initiation factor 4A3 (EIF4A3), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22961380 CWC22 escorts the helicase eIF4AIII to spliceosomes and promotes exon junction complex assembly
21576267 demonstrate direct physical interactions between yeast Sgd1p and Fal1p, and between their human orthologs (NOM1 and eIF4AIII) in vitro and in vivo, identifying human NOM1 as a missing eIF4G-like interacting partner of eIF4AIII
18427545 The nonsense-mediated-decay mRNA surveillance pathway downregulates aberrant E-cadherin transcripts in gastric cancer cells and in CDH1 mutation carriers.
More...

AA Sequence

MATTATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIK      1 - 70
QIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHAC     71 - 140
IGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPP    141 - 210
ATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQA    211 - 280
VIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLII    281 - 350
NYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI             351 - 411
//

Text Mined References (68)

PMID Year Title
26773380 2016 The eIF4AIII RNA helicase is a critical determinant of human cytomegalovirus replication.
26382858 2015 mRNA export through an additional cap-binding complex consisting of NCBP1 and NCBP3.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24360810 2014 A noncoding expansion in EIF4A3 causes Richieri-Costa-Pereira syndrome, a craniofacial disorder associated with limb defects.
24218557 2013 Crystal structure of the human eIF4AIII-CWC22 complex shows how a DEAD-box protein is inhibited by a MIF4G domain.
23236153 2012 Human spliceosomal protein CWC22 plays a role in coupling splicing to exon junction complex deposition and nonsense-mediated decay.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...