Property Summary

NCBI Gene PubMed Count 49
Grant Count 120
R01 Count 61
Funding $14,021,388.76
PubMed Score 377.46
PubTator Score 130.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.237 0.018
Multiple myeloma 1.064 0.034
Pick disease -1.200 0.000
ovarian cancer -1.900 0.000

Synonym

Accession P38570 Q17RS6 Q9NZU9
Symbols CD103
HUMINAE

Gene

Gene RIF (33)

PMID Text
26813744 detected CD103 tumor cells in 41% (16/39) of lymph node-involved adult T-cell leukemia/lymphoma
26522261 Levels of GZMA and ITGAE mRNAs in colon tissues can identify patients with UC who are most likely to benefit from etrolizumab; expression levels decrease with etrolizumab administration in biomarker(high) patients.
25957117 PD-1(+)CD103(+) CD8 TIL might regain functional antitumor activity, an effect that potentially could be augmented by immune modulation.
25637255 This report highlights the diagnostic difficulties and the need of consensus in categorizing clonal CD103(+) lymphocytosis in patients with refractory celiac disease.
25584868 Cell-sorting experiments demonstrated that IDO1 expression is found in a subset of CD1a(+)CD14(-)langerin(+) cells, expressing CD103
25025448 Report CD103 expression occurs most frequently in gastrointestinal T-cell lymphomas.
24477908 Using a human CTL system model based on a CD8(+)/CD103(-) T cell clone specific of a lung tumor-associated Ag, we demonstrated that the transcription factors Smad2/3 and NFAT-1 are two critical regulators of this process.
24190978 Tumor-infiltrating lymphocytes expressing the tissue resident memory marker CD103 are associated with increased survival in high-grade serous ovarian cancer.
22922816 Memory CD103+ CD8 T cells that persist within the brain after an acute infection with vesicular stomatitis virus are bona fide tissue resident memory cells.
21948982 Lymphoid tissue (LT)-resident CD8alpha-positive dendritic cells (DCs) and non(LT)-derived CD103-positive DCs express transgenic XCR1 and are characterized by a unique transcriptional fingerprint, irrespective of their tissue of origin.
More...

AA Sequence

MWLFHTLLCIASLALLAAFNVDVARPWLTPKGGAPFVLSSLLHQDPSTNQTWLLVTSPRTKRTPGPLHRC      1 - 70
SLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSSELTGTCSLLGPDLRPQAQAN     71 - 140
FFDLENLLDPDARVDTGDCYSNKEGGGEDDVNTARQRRALEKEEEEDKEEEEDEEEEEAGTEIAIILDGS    141 - 210
GSIDPPDFQRAKDFISNMMRNFYEKCFECNFALVQYGGVIQTEFDLRDSQDVMASLARVQNITQVGSVTK    211 - 280
TASAMQHVLDSIFTSSHGSRRKASKVMVVLTDGGIFEDPLNLTTVINSPKMQGVERFAIGVGEEFKSART    281 - 350
ARELNLIASDPDETHAFKVTNYMALDGLLSKLRYNIISMEGTVGDALHYQLAQIGFSAQILDERQVLLGA    351 - 420
VGAFDWSGGALLYDTRSRRGRFLNQTAAAAADAEAAQYSYLGYAVAVLHKTCSLSYIAGAPRYKHHGAVF    421 - 490
ELQKEGREASFLPVLEGEQMGSYFGSELCPVDIDMDGSTDFLLVAAPFYHVHGEEGRVYVYRLSEQDGSF    491 - 560
SLARILSGHPGFTNARFGFAMAAMGDLSQDKLTDVAIGAPLEGFGADDGASFGSVYIYNGHWDGLSASPS    561 - 630
QRIRASTVAPGLQYFGMSMAGGFDISGDGLADITVGTLGQAVVFRSRPVVRLKVSMAFTPSALPIGFNGV    631 - 700
VNVRLCFEISSVTTASESGLREALLNFTLDVDVGKQRRRLQCSDVRSCLGCLREWSSGSQLCEDLLLMPT    701 - 770
EGELCEEDCFSNASVKVSYQLQTPEGQTDHPQPILDRYTEPFAIFQLPYEKACKNKLFCVAELQLATTVS    771 - 840
QQELVVGLTKELTLNINLTNSGEDSYMTSMALNYPRNLQLKRMQKPPSPNIQCDDPQPVASVLIMNCRIG    841 - 910
HPVLKRSSAHVSVVWQLEENAFPNRTADITVTVTNSNERRSLANETHTLQFRHGFVAVLSKPSIMYVNTG    911 - 980
QGLSHHKEFLFHVHGENLFGAEYQLQICVPTKLRGLQVVAVKKLTRTQASTVCTWSQERACAYSSVQHVE    981 - 1050
EWHSVSCVIASDKENVTVAAEISWDHSEELLKDVTELQILGEISFNKSLYEGLNAENHRTKITVVFLKDE   1051 - 1120
KYHSLPIIIKGSVGGLLVLIVILVILFKCGFFKRKYQQLNLESIRKAQLKSENLLEEEN              1121 - 1179
//

Text Mined References (50)

PMID Year Title
26813744 2016 High Expression of Intestinal Homing Receptor CD103 in Adult T-Cell Leukemia/Lymphoma, Similar to 2 Other CD8+ T-Cell Lymphomas.
26522261 2016 Association Between Response to Etrolizumab and Expression of Integrin ?E and Granzyme A in Colon Biopsies of Patients With Ulcerative Colitis.
25957117 2015 PD-1 and CD103 Are Widely Coexpressed on Prognostically Favorable Intraepithelial CD8 T Cells in Human Ovarian Cancer.
25637255 2015 CD103+ ?? T cell large granular lymphocytosis in a patient with refractory celiac disease: a diagnostic enigma.
25584868 2015 CD103 marks a subset of human CD34+-derived langerin+ dendritic cells that induce T-regulatory cells via indoleamine 2,3-dioxygenase-1.
25025448 2014 Profile of CD103 expression in T-cell neoplasms: immunoreactivity is not restricted to enteropathy-associated T-cell lymphoma.
24477908 2014 Smad and NFAT pathways cooperate to induce CD103 expression in human CD8 T lymphocytes.
24190978 2014 Tumor-infiltrating lymphocytes expressing the tissue resident memory marker CD103 are associated with increased survival in high-grade serous ovarian cancer.
22922816 2012 The molecular signature of tissue resident memory CD8 T cells isolated from the brain.
21948982 2011 Cutting edge: expression of XCR1 defines mouse lymphoid-tissue resident and migratory dendritic cells of the CD8?+ type.
More...