Property Summary

NCBI Gene PubMed Count 66
PubMed Score 206.53
PubTator Score 276.82

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.800 8.4e-04
lung cancer 1.100 1.1e-02
malignant mesothelioma 1.200 1.4e-04
osteosarcoma -1.130 2.9e-03
ovarian cancer 1.300 1.5e-02

Synonym

Accession P38432 B2R931
Symbols CLN80
p80-coilin

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (30)

AA Sequence

MAASETVRLRLQFDYPPPATPHCTAFWLLVDLNRCRVVTDLISLIRQRFGFSSGAFLGLYLEGGLLPPAE      1 - 70
SARLVRDNDCLRVKLEERGVAENSVVISNGDINLSLRKAKKRAFQLEEGEETEPDCKYSKKHWKSRENNN     71 - 140
NNEKVLDLEPKAVTDQTVSKKNKRKNKATCGTVGDDNEEAKRKSPKKKEKCEYKKKAKNPKSPKVQAVKD    141 - 210
WANQRCSSPKGSARNSLVKAKRKGSVSVCSKESPSSSSESESCDESISDGPSKVTLEARNSSEKLPTELS    211 - 280
KEEPSTKNTTADKLAIKLGFSLTPSKGKTSGTTSSSSDSSAESDDQCLMSSSTPECAAGFLKTVGLFAGR    281 - 350
GRPGPGLSSQTAGAAGWRRSGSNGGGQAPGASPSVSLPASLGRGWGREENLFSWKGAKGRGMRGRGRGRG    351 - 420
HPVSCVVNRSTDNQRQQQLNDVVKNSSTIIQNPVETPKKDYSLLPLLAAAPQVGEKIAFKLLELTSSYSP    421 - 490
DVSDYKEGRILSHNPETQQVDIEILSSLPALREPGKFDLVYHNENGAEVVEYAVTQESKITVFWKELIDP    491 - 560
RLIIESPSNTSSTEPA                                                          561 - 576
//

Text Mined References (78)

PMID Year Title