Property Summary

NCBI Gene PubMed Count 63
Grant Count 109
R01 Count 50
Funding $12,085,473.21
PubMed Score 198.56
PubTator Score 276.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
osteosarcoma -1.130 0.003
group 3 medulloblastoma 1.800 0.001
lung cancer 1.300 0.000
ovarian cancer 1.300 0.015

Synonym

Accession P38432 B2R931
Symbols CLN80
p80-coilin

Gene

 GO Function (1)

Gene RIF (30)

PMID Text
26068304 VRK1 is a novel regulator of CBs dynamics and stability in cell cycle by protecting coilin from ubiquitination and degradation in the proteasome, and propose a model of CB dynamics.
25970135 Authors summarize what has been learned in the past 25 years about coilin's structure, post-transcriptional modifications, and interactions with RNA and proteins. [Review]
25514182 Coilin couples snRNA and snoRNA biogenesis, making cajal bodies the cellular hub of small ncRNA metabolism.
25477378 The study shows that coilin-KO human cells that lack Cajal bodies are phenotypically normal with respect to telomere homeostasis.
25347736 Data indicate that annexin A2 overexpression in microsatellite instability (MIN) cells induces disassembly and colocalization of coilin with centromeres.
24413165 The interaction of SMN with the spliceosomal SmD1 (also known as SNRPD1), severely decreases SMN-coilin interaction and prevents Cajal body assembly.
23726919 Results suggest that UBL5 could be targeted to Cajal bodies (CBs) via its interaction with coilin.
23274112 Data indicate coilin involvement in the processing of telomerase RNA both in vitro and in vivo.
23064547 coilin is subjected to regulated specific proteolysis by calpain, and this processing may play a role in the regulation of coilin activity and Cajal body formation
22986342 investigated the role of coilin in the DNA damage response and found that coilin reduction correlated with significantly increased levels of soluble gammaH2AX in etoposide treated U2OS cells
More...

AA Sequence

MAASETVRLRLQFDYPPPATPHCTAFWLLVDLNRCRVVTDLISLIRQRFGFSSGAFLGLYLEGGLLPPAE      1 - 70
SARLVRDNDCLRVKLEERGVAENSVVISNGDINLSLRKAKKRAFQLEEGEETEPDCKYSKKHWKSRENNN     71 - 140
NNEKVLDLEPKAVTDQTVSKKNKRKNKATCGTVGDDNEEAKRKSPKKKEKCEYKKKAKNPKSPKVQAVKD    141 - 210
WANQRCSSPKGSARNSLVKAKRKGSVSVCSKESPSSSSESESCDESISDGPSKVTLEARNSSEKLPTELS    211 - 280
KEEPSTKNTTADKLAIKLGFSLTPSKGKTSGTTSSSSDSSAESDDQCLMSSSTPECAAGFLKTVGLFAGR    281 - 350
GRPGPGLSSQTAGAAGWRRSGSNGGGQAPGASPSVSLPASLGRGWGREENLFSWKGAKGRGMRGRGRGRG    351 - 420
HPVSCVVNRSTDNQRQQQLNDVVKNSSTIIQNPVETPKKDYSLLPLLAAAPQVGEKIAFKLLELTSSYSP    421 - 490
DVSDYKEGRILSHNPETQQVDIEILSSLPALREPGKFDLVYHNENGAEVVEYAVTQESKITVFWKELIDP    491 - 560
RLIIESPSNTSSTEPA                                                          561 - 576
//

Text Mined References (74)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26068304 2015 VRK1 regulates Cajal body dynamics and protects coilin from proteasomal degradation in cell cycle.
25970135 2015 Coilin: The first 25 years.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25514182 2014 The coilin interactome identifies hundreds of small noncoding RNAs that traffic through Cajal bodies.
25477378 2015 Human cells lacking coilin and Cajal bodies are proficient in telomerase assembly, trafficking and telomere maintenance.
25416956 2014 A proteome-scale map of the human interactome network.
25347736 2015 Nuclear accumulation of annexin A2 contributes to chromosomal instability by coilin-mediated centromere damage.
24413165 2014 The SMN Tudor SIM-like domain is key to SmD1 and coilin interactions and to Cajal body biogenesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...