Property Summary

NCBI Gene PubMed Count 239
Grant Count 188
R01 Count 115
Funding $20,213,481.14
PubMed Score 560.75
PubTator Score 358.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (50)

Disease Z-score Confidence
Cancer 2,346 5.505 2.8
Posterior polymorphous corneal dystrophy 24 5.46 2.7
Fuchs' endothelial dystrophy 20 4.352 2.2
Breast cancer 3,094
CORNEAL DYSTROPHY, FUCHS ENDOTHELIAL, 6 1
CORNEAL DYSTROPHY, POSTERIOR POLYMORPHOU... 1 
Carcinoma 2,147 1.0
Disease Progression 125
Endometrial Neoplasms 50
Gaucher disease type 3 76
Lymphoma, T-Cell, Cutaneous 21
Mammary Neoplasms 410
Myocardial Ischemia 169
Neoplasm Invasiveness 127
Neoplastic Cell Transformation 81
Sezary Syndrome 26
aldosterone-producing adenoma 664
astrocytic glioma 2,241
autosomal dominant Emery-Dreifuss muscul... 499 
colon cancer 1,475
cystic fibrosis 1,665
ductal carcinoma in situ 1,745
ependymoma 2,514
gastric carcinoma 832
glioblastoma 5,572
hereditary spastic paraplegia 313
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
lung adenocarcinoma 2,713
lung cancer 4,466
medulloblastoma, large-cell 6,234
non-small cell lung cancer 2,798
oligodendroglioma 2,849
osteosarcoma 7,933
ovarian cancer 8,484
ovarian neoplasm 97
pancreatic cancer 2,300
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
primary Sjogren syndrome 789
primary pancreatic ductal adenocarcinoma 1,271
primitive neuroectodermal tumor 3,031
psoriasis 6,685
sonic hedgehog group medulloblastoma 1,482
subependymal giant cell astrocytoma 2,287
tuberculosis 1,557
ulcerative colitis 2,087

Expression

Synonym

Accession P37275 B4DJV0 B4DUW9 E9PCM7 F5H4I8 Q12924 Q13800 Q2KJ05 Q5T968 Q5VZ84 Q8NB68
Symbols BZP
TCF8
AREB6
FECD6
NIL2A
PPCD3
ZFHEP
ZFHX1A
DELTAEF1

Gene

PDB

2E19  

Gene RIF (221)

PMID Text
26940738 expression of ZEB1 and TWIST1, which are master regulators of tumor metastasis. Our study first indicates that miR-1271 functions as a suppressor in regulating of pancreatic cancer EMT by targeting ZEB1 and TWIST1.
26898939 Results indicate that linc-ROR acts as an important regulator of ZEB1, can promote invasion and metastasis in pancreatic cancer.
26882471 Collectively, we found that ZEB1-expressing breast cancer cells increase VEGFA production and thus stimulate tumor growth and angiogenesis via a paracrine mechanism.
26876920 A direct interaction of ZEB1 with the Hippo pathway effector YAP, in which ZEB1 switches its function to a transcriptional co-activator of a 'common ZEB1/YAP target gene set', links two pathways with similar cancer promoting effects.
26823172 suggest that deltaEF1 family proteins promote cell motility of breast cancer cells directly or indirectly through repressing expression of RGS16
26717907 SET8 and ZEB1 are functionally interdependent in promoting the epithelial-mesenchymal transition and enhancing the invasive potential of prostate cancer cells in vitro.
26622166 ZEB1 mutations and TCF4 rs613872 changes are associated with late onset Fuchs endothelial corneal dystrophy in patients from Northern India.
26619383 we report posterior polymorphous corneal dystrophy resulting from a de novo mutation in ZEB1. Additionally, we present a congenital hereditary endothelial dystrophy case with a thin Descemet membrane with a novel compound heterozygous SLC4A11 mutation.
26617850 The upregulation of ZEB1 is associated with the abnormal expression of E-cadherin, beta-catenin and N-cadherin, which might promote the progression and metastasis of cervical squamous cell carcinoma.
26556542 Our study first indicates that miR-590-3p functions as a suppressor of GBM EMT and metastasis by targeting ZEB1 and ZEB2, and it may be a therapeutic target for metastatic GBM.
More...

AA Sequence

MADGPRCKRRKQANPRRNNVTNYNTVVETNSDSDDEDKLHIVEEESVTDAADCEGVPEDDLPTDQTVLPG      1 - 70
RSSEREGNAKNCWEDDRKEGQEILGPEAQADEAGCTVKDDECESDAENEQNHDPNVEEFLQQQDTAVIFP     71 - 140
EAPEEDQRQGTPEASGHDENGTPDAFSQLLTCPYCDRGYKRFTSLKEHIKYRHEKNEDNFSCSLCSYTFA    141 - 210
YRTQLERHMTSHKSGRDQRHVTQSGCNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHS    211 - 280
GSYSSHISSKKCISLIPVNGRPRTGLKTSQCSSPSLSASPGSPTRPQIRQKIENKPLQEQLSVNQIKTEP    281 - 350
VDYEFKPIVVASGINCSTPLQNGVFTGGGPLQATSSPQGMVQAVVLPTVGLVSPISINLSDIQNVLKVAV    351 - 420
DGNVIRQVLENNQANLASKEQETINASPIQQGGHSVISAISLPLVDQDGTTKIIINYSLEQPSQLQVVPQ    421 - 490
NLKKENPVATNSCKSEKLPEDLTVKSEKDKSFEGGVNDSTCLLCDDCPGDINALPELKHYDLKQPTQPPP    491 - 560
LPAAEAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFE    561 - 630
KMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGSTTNGSRS    631 - 700
STPSPSPLNLSSSRNTQGYLYTAEGAQEEPQVEPLDLSLPKQQGELLERSTITSVYQNSVYSVQEEPLNL    701 - 770
SCAKKEPQKDSCVTDSEPVVNVIPPSANPINIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQ    771 - 840
VAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTENGMYACDLCD    841 - 910
KIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMN    911 - 980
HRYSYCKREAEERDSTEQEEAGPEILSNEHVGARASPSQGDSDERESLTREEDEDSEKEEEEEDKEMEEL    981 - 1050
QEEKECEKPQGDEEEEEEEEEVEEEEVEEAENEGEEAKTEGLMKDDRAESQASSLGQKVGESSEQVSEEK   1051 - 1120
TNEA                                                                     1121 - 1124
//

Text Mined References (251)

PMID Year Title
26940738 2016 miR-1271 inhibits migration, invasion and epithelial-mesenchymal transition by targeting ZEB1 and TWIST1 in pancreatic cancer cells.
26898939 2016 LincRNA-ROR promotes invasion, metastasis and tumor growth in pancreatic cancer through activating ZEB1 pathway.
26882471 2016 ZEB1 Upregulates VEGF Expression and Stimulates Angiogenesis in Breast Cancer.
26876920 2016 ZEB1 turns into a transcriptional activator by interacting with YAP1 in aggressive cancer types.
26823172 2016 The potential role of regulator of G-protein signaling 16 in cell motility mediated by ?EF1 family proteins.
26717907 2016 SET8 induces epithelial?mesenchymal transition and enhances prostate cancer cell metastasis by cooperating with ZEB1.
26622166 2015 Association of ZEB1 and TCF4 rs613872 changes with late onset Fuchs endothelial corneal dystrophy in patients from northern India.
26619383 2016 Congenital Corneal Endothelial Dystrophies Resulting From Novel De Novo Mutations.
26617850 2015 ZEB1 promotes the progression and metastasis of cervical squamous cell carcinoma via the promotion of epithelial-mesenchymal transition.
26556542 2015 miR-590-3p suppresses cancer cell migration, invasion and epithelial-mesenchymal transition in glioblastoma multiforme by targeting ZEB1 and ZEB2.
More...