Property Summary

NCBI Gene PubMed Count 305
PubMed Score 659.22
PubTator Score 358.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.7
Skin cancer 469 0.0 0.5
Disease Target Count Z-score Confidence
Keratoconus 113 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2499 5.723 2.9
Posterior polymorphous corneal dystrophy 19 5.657 2.8
Disease Target Count
Fuchs' endothelial dystrophy 24

Expression

  Differential Expression (35)

Disease log2 FC p
lung cancer -1.100 2.5e-03
aldosterone-producing adenoma -1.063 1.7e-02
astrocytic glioma 2.000 2.3e-02
Astrocytoma, Pilocytic 2.300 6.6e-05
autosomal dominant Emery-Dreifuss muscul... -1.190 3.6e-02
Breast cancer 1.600 1.5e-05
colon cancer -2.400 2.1e-05
cystic fibrosis 1.148 1.1e-03
ductal carcinoma in situ -1.200 1.1e-02
ependymoma 1.800 1.4e-05
gastric carcinoma 1.300 3.0e-02
Gaucher disease type 3 -1.100 1.0e-02
glioblastoma 1.600 2.5e-03
group 4 medulloblastoma 2.600 8.4e-04
hereditary spastic paraplegia -1.033 2.5e-03
intraductal papillary-mucinous adenoma (... -1.400 3.6e-02
intraductal papillary-mucinous carcinoma... -2.000 3.0e-03
intraductal papillary-mucinous neoplasm ... -2.000 1.5e-02
invasive ductal carcinoma -1.300 2.1e-02
juvenile dermatomyositis 1.170 1.3e-05
lung adenocarcinoma -1.100 1.2e-09
medulloblastoma, large-cell 1.900 1.3e-04
non-small cell lung cancer -1.106 2.6e-09
oligodendroglioma 2.000 3.9e-02
osteosarcoma 3.172 3.3e-06
ovarian cancer -1.400 2.2e-09
pancreatic cancer 1.900 3.8e-03
pediatric high grade glioma 2.100 4.0e-03
primary pancreatic ductal adenocarcinoma 2.132 1.4e-02
primary Sjogren syndrome 1.300 1.5e-04
primitive neuroectodermal tumor 1.300 1.9e-02
psoriasis -1.100 1.5e-04
subependymal giant cell astrocytoma 1.668 3.6e-02
tuberculosis -2.000 1.6e-06
ulcerative colitis 1.900 1.1e-04

Gene RIF (287)

AA Sequence

MADGPRCKRRKQANPRRNNVTNYNTVVETNSDSDDEDKLHIVEEESVTDAADCEGVPEDDLPTDQTVLPG      1 - 70
RSSEREGNAKNCWEDDRKEGQEILGPEAQADEAGCTVKDDECESDAENEQNHDPNVEEFLQQQDTAVIFP     71 - 140
EAPEEDQRQGTPEASGHDENGTPDAFSQLLTCPYCDRGYKRFTSLKEHIKYRHEKNEDNFSCSLCSYTFA    141 - 210
YRTQLERHMTSHKSGRDQRHVTQSGCNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHS    211 - 280
GSYSSHISSKKCISLIPVNGRPRTGLKTSQCSSPSLSASPGSPTRPQIRQKIENKPLQEQLSVNQIKTEP    281 - 350
VDYEFKPIVVASGINCSTPLQNGVFTGGGPLQATSSPQGMVQAVVLPTVGLVSPISINLSDIQNVLKVAV    351 - 420
DGNVIRQVLENNQANLASKEQETINASPIQQGGHSVISAISLPLVDQDGTTKIIINYSLEQPSQLQVVPQ    421 - 490
NLKKENPVATNSCKSEKLPEDLTVKSEKDKSFEGGVNDSTCLLCDDCPGDINALPELKHYDLKQPTQPPP    491 - 560
LPAAEAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFE    561 - 630
KMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGSTTNGSRS    631 - 700
STPSPSPLNLSSSRNTQGYLYTAEGAQEEPQVEPLDLSLPKQQGELLERSTITSVYQNSVYSVQEEPLNL    701 - 770
SCAKKEPQKDSCVTDSEPVVNVIPPSANPINIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQ    771 - 840
VAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTENGMYACDLCD    841 - 910
KIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMN    911 - 980
HRYSYCKREAEERDSTEQEEAGPEILSNEHVGARASPSQGDSDERESLTREEDEDSEKEEEEEDKEMEEL    981 - 1050
QEEKECEKPQGDEEEEEEEEEVEEEEVEEAENEGEEAKTEGLMKDDRAESQASSLGQKVGESSEQVSEEK   1051 - 1120
TNEA                                                                     1121 - 1124
//

Text Mined References (318)

PMID Year Title