Property Summary

NCBI Gene PubMed Count 36
Grant Count 4
Funding $328,060.33
PubMed Score 38.35
PubTator Score 51.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.300 0.001
group 3 medulloblastoma 1.100 0.027

Synonym

Accession P36957 B7Z5W8 E7ESY5 Q7LDY7 Q9BQ32
Symbols DLTS

Gene

PANTHER Protein Class (2)

Gene RIF (12)

PMID Text
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of dihydrolipoamide S-succinyltransferase (DLST) expression by HIV-1 Vpr in Vpr transduced macrophages
23475850 ATP consumption is demonstrated in respiration-impaired isolated and in situ neuronal somal mitochondria from transgenic mice that exhibit a 20-48% decrease in alpha-ketoglutarate dehydrogenase activity.
22632162 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of dihydrolipoamide S-succinyltransferase (DLST) expression by HIV-1 Vpr in Vpr transduced macrophages
22235656 2-oxoglutarate dehydrogenase complex (OGDHC), the key regulatory enzyme of Krebs cycle. [review]
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18976975 Knockdown of dihydrolipoamide S-succinyltransferase (DLST) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
15038610 Association between late-onset Alzheimer disease shows strong linkage disequilibrium across the DLST locus.
12805207 Data show that the dihydrolipoamide succinyltransferase gene is bifunctional, and truncated mRNA transcribed from it contributes to the biogenesis of the mitochondrial respiratory complexes.
11825528 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVFSVRFFRTTAVCKDDL      1 - 70
VTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPL     71 - 140
FTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPL    141 - 210
AEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGF    211 - 280
MSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITEL    281 - 350
GEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVAL    351 - 420
TYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL                                         421 - 453
//

Text Mined References (42)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23475850 2013 The negative impact of ?-ketoglutarate dehydrogenase complex deficiency on matrix substrate-level phosphorylation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23144319 2013 Prognostic implications of genetic variants in advanced non-small cell lung cancer: a genome-wide association study.
22235656 2011 [2-Oxoglutarate dehydrogenase complex and its multipoint control].
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...