Property Summary

NCBI Gene PubMed Count 37
PubMed Score 55.43
PubTator Score 51.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Wernicke-Korsakoff syndrome 10
Disease Target Count P-value
psoriasis 6694 1.1e-03
group 3 medulloblastoma 4104 2.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
lung cancer 4740 0.0 0.9
Disease Target Count Z-score Confidence
Reye syndrome 11 3.152 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.100 2.7e-02
psoriasis -1.300 1.1e-03

Gene RIF (13)

AA Sequence

MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVFSVRFFRTTAVCKDDL      1 - 70
VTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPL     71 - 140
FTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPL    141 - 210
AEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGF    211 - 280
MSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITEL    281 - 350
GEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVAL    351 - 420
TYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL                                         421 - 453
//

Text Mined References (43)

PMID Year Title