Property Summary

NCBI Gene PubMed Count 35
PubMed Score 86.33
PubTator Score 459.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Retinitis Pigmentosa 226 3.467 1.7

Expression

Synonym

Accession P36575 B5B0B9 Q5JT23 Q5JT24 Q6IBF5 Q96EN2
Symbols ARRX
cArr
MYP26

Gene

PANTHER Protein Class (1)

PDB

1XEH   2A34  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (18)

AA Sequence

MSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVDPEYLKCRKLFVMLTCAFRYGRDDLEVIGLT      1 - 70
FRKDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVTLQPGPEDAGKPCGID     71 - 140
FEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPSAQTIRRFLLSAQPLQLQAWMDREVHYHGEP    141 - 210
ISVNVSINNCTNKVIKKIKISVDQITDVVLYSLDKYTKTVFIQEFTETVAANSSFSQSFAVTPILAASCQ    211 - 280
KRGLALDGKLKHEDTNLASSTIIRPGMDKELLGILVSYKVRVNLMVSCGGILGDLTASDVGVELPLVLIH    281 - 350
PKPSHEAASSEDIVIEEFTRKGEEESQKAVEAEGDEGS                                    351 - 388
//

Text Mined References (36)

PMID Year Title