Property Summary

NCBI Gene PubMed Count 35
Grant Count 44
R01 Count 34
Funding $4,482,361.86
PubMed Score 78.92
PubTator Score 459.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Retinitis pigmentosa 153 3.5 1.7

Expression

Gene RIF (18)

PMID Text
25425623 In the cell membrane, arrestin-3 dissociates quickly and almost completely from the Beta2-adrenoceptor.
24867953 Identification of receptor binding-induced conformational changes in non-visual arrestins.
24412749 The 25-amino acid N-domain element of arrestin 3 has the highest affinity for JNK3alpha2, suggesting that it is the key site for JNK3alpha2 docking.
24292834 arrestin-3 regulates the activity of multiple JNK isoforms, suggesting that it might play a role in survival and apoptosis of all cell types.
23139825 These data suggest cell type- and subcellular compartment-dependent differences in GRK/arrestin-mediated desensitization and signaling.
22523077 Silent scaffolds: inhibition OF c-Jun N-terminal kinase 3 activity in cell by dominant-negative arrestin-3 mutant.
22378779 the TGN acts as a checkpoint for both the recycling and down-regulation of beta1AR and arrestin-3 not only mediates beta1AR endocytosis but also its recycling through the TGN
22242112 PP2A inhibits association between the Na+,K+-ATPase and arrestin, and diminishes the effect of arrestin on Na+,K+-ATPase trafficking.
21203429 upon ligand activation, CysLT(1)R is tyrosine-phosphorylated and released from heterodimers with CysLT(2)R and, subsequently, internalizes from the plasma membrane to the nuclear membrane in a clathrin-, arrestin-3-, and Rab-5-dependent manner
20460384 The agonist-induced internalization of GPR109A receptors is regulated by GRK2 and arrestin3 in a pertussis toxin-sensitive manner and that internalized receptor recycling is independent of endosomal acidification.
More...

AA Sequence

MSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVDPEYLKCRKLFVMLTCAFRYGRDDLEVIGLT      1 - 70
FRKDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVTLQPGPEDAGKPCGID     71 - 140
FEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPSAQTIRRFLLSAQPLQLQAWMDREVHYHGEP    141 - 210
ISVNVSINNCTNKVIKKIKISVDQITDVVLYSLDKYTKTVFIQEFTETVAANSSFSQSFAVTPILAASCQ    211 - 280
KRGLALDGKLKHEDTNLASSTIIRPGMDKELLGILVSYKVRVNLMVSCGGILGDLTASDVGVELPLVLIH    281 - 350
PKPSHEAASSEDIVIEEFTRKGEEESQKAVEAEGDEGS                                    351 - 388
//

Text Mined References (36)

PMID Year Title
25425623 2015 Engineered hyperphosphorylation of the ?2-adrenoceptor prolongs arrestin-3 binding and induces arrestin internalization.
25416956 2014 A proteome-scale map of the human interactome network.
24867953 2014 Identification of receptor binding-induced conformational changes in non-visual arrestins.
24412749 2014 Arrestin-3 binds the MAP kinase JNK3?2 via multiple sites on both domains.
24292834 2014 Arrestin-dependent activation of JNK family kinases.
23704327 2013 The giant spectrin ?V couples the molecular motors to phototransduction and Usher syndrome type I proteins along their trafficking route.
23139825 2012 Distinct cellular and subcellular distributions of G protein-coupled receptor kinase and arrestin isoforms in the striatum.
22523077 2012 Silent scaffolds: inhibition OF c-Jun N-terminal kinase 3 activity in cell by dominant-negative arrestin-3 mutant.
22378779 2012 Trans-Golgi Network (TGN) as a regulatory node for ?1-adrenergic receptor (?1AR) down-modulation and recycling.
22242112 2011 Protein phosphatase 2A interacts with the Na,K-ATPase and modulates its trafficking by inhibition of its association with arrestin.
More...