Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.32
PubTator Score 4.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
malignant mesothelioma 3,162

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.800 0.000

Gene RIF (6)

PMID Text
20546612 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
16337145 Our study shows that ZNF76, a TBP-interacting transcriptional modulator, is regulated by both lysine modifications and alternative splicing.
15280358 ZNF76 functions as a transcriptional repressor through its interaction with TBP and sumoylation modulates its transcriptional repression activity

AA Sequence

MESLGLHTVTLSDGTTAYVQQAVKGEKLLEGQVIQLEDGTTAYIHQVTVQKEALSFEDGQPVQLEDGSMA      1 - 70
YIHRTPREGYDPSTLEAVQLEDGSTAYIHHPVAVPSESTILAVQTEVGLEDLAAEDDEGFSADAVVALEQ     71 - 140
YASKVLHDSQIPRNGKGQQVGDRAFRCGYKGCGRLYTTAHHLKVHERAHTGDRPYRCDFPSCGKAFATGY    141 - 210
GLKSHVRTHTGEKPYKCPEELCSKAFKTSGDLQKHVRTHTGERPFQCPFEGCGRSFTTSNIRKVHVRTHT    211 - 280
GERPYTCPEPHCGRGFTSATNYKNHVRIHTGEKPYVCTVPGCGKRFTEYSSLYKHHVVHTHCKPYTCSTC    281 - 350
GKTYRQTSTLAMHKRSAHGELEATEESEQALYEQQQLEAASAAEESPPPKRPRIAYLSEVKEERDDIPAQ    351 - 420
VAMVTEEDGAPQVALITQDGAQQVSLSPEDLQALGSAISMVTQHGSTTLTIPSPDADLATSGTHTVTMVS    421 - 490
ADGTQTQPVTIITSGAVVAEDSSVASLRHQQVALLATANGTHIAVQLEEQQTLEEAINVATAAMQQGAVT    491 - 560
LETTVSESGC                                                                561 - 570
//

Text Mined References (13)

PMID Year Title
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
18391951 2008 Many sequence variants affecting diversity of adult human height.
16522640 2006 Interaction of protein inhibitor of activated STAT (PIAS) proteins with the TATA-binding protein, TBP.
16337145 2006 Acetylation and alternative splicing regulate ZNF76-mediated transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15280358 2004 ZNF76, a novel transcriptional repressor targeting TATA-binding protein, is modulated by sumoylation.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
More...