Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.36
PubTator Score 4.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3232 2.4e-07
Disease Target Count Z-score Confidence
Cataract 297 3.105 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.800 2.4e-07

Gene RIF (6)

AA Sequence

MESLGLHTVTLSDGTTAYVQQAVKGEKLLEGQVIQLEDGTTAYIHQVTVQKEALSFEDGQPVQLEDGSMA      1 - 70
YIHRTPREGYDPSTLEAVQLEDGSTAYIHHPVAVPSESTILAVQTEVGLEDLAAEDDEGFSADAVVALEQ     71 - 140
YASKVLHDSQIPRNGKGQQVGDRAFRCGYKGCGRLYTTAHHLKVHERAHTGDRPYRCDFPSCGKAFATGY    141 - 210
GLKSHVRTHTGEKPYKCPEELCSKAFKTSGDLQKHVRTHTGERPFQCPFEGCGRSFTTSNIRKVHVRTHT    211 - 280
GERPYTCPEPHCGRGFTSATNYKNHVRIHTGEKPYVCTVPGCGKRFTEYSSLYKHHVVHTHCKPYTCSTC    281 - 350
GKTYRQTSTLAMHKRSAHGELEATEESEQALYEQQQLEAASAAEESPPPKRPRIAYLSEVKEERDDIPAQ    351 - 420
VAMVTEEDGAPQVALITQDGAQQVSLSPEDLQALGSAISMVTQHGSTTLTIPSPDADLATSGTHTVTMVS    421 - 490
ADGTQTQPVTIITSGAVVAEDSSVASLRHQQVALLATANGTHIAVQLEEQQTLEEAINVATAAMQQGAVT    491 - 560
LETTVSESGC                                                                561 - 570
//

Text Mined References (15)

PMID Year Title