Property Summary

NCBI Gene PubMed Count 82
PubMed Score 377.50
PubTator Score 167.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Chromosome 1q21.1 deletion syndrome 12 0.0 5.0
Disease Target Count Z-score Confidence
Cardiomyopathy 116 0.0 4.0
Familial atrial fibrillation 23 0.0 4.0

Expression

  Differential Expression (7)

Disease log2 FC p
Breast cancer 2.000 1.0e-02
interstitial cystitis 1.600 1.3e-02
lung adenocarcinoma -1.300 1.8e-08
lung carcinoma -1.800 3.6e-10
non diabetic and post-ischemic heart fai... 1.200 4.8e-02
non-small cell lung cancer -1.415 2.2e-08
ovarian cancer 1.500 5.1e-03

Gene RIF (59)

AA Sequence

MGDWSFLGNFLEEVHKHSTVVGKVWLTVLFIFRMLVLGTAAESSWGDEQADFRCDTIQPGCQNVCYDQAF      1 - 70
PISHIRYWVLQIIFVSTPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGSGSYEYPVAEKAELSCWEEGN     71 - 140
GRIALQGTLLNTYVCSILIRTTMEVGFIVGQYFIYGIFLTTLHVCRRSPCPHPVNCYVSRPTEKNVFIVF    141 - 210
MLAVAALSLLLSLAELYHLGWKKIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFF    211 - 280
NPFSNNMASQQNTDNLVTEQVRGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDKRRLSKASSK    281 - 350
ARSDDLSV                                                                  351 - 358
//

Text Mined References (81)

PMID Year Title