Property Summary

NCBI Gene PubMed Count 89
PubMed Score 552.49
PubTator Score 5693.28

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
Barrett's esophagus 4.400 3.3e-02
colon cancer -1.600 6.2e-03
interstitial cystitis -3.500 2.9e-03
intraductal papillary-mucinous carcinoma... 3.600 2.6e-02
psoriasis -1.300 9.2e-10

Gene RIF (77)

AA Sequence

MDFSRRSFHRSLSSSLQAPVVSTVGMQRLGTTPSVYGGAGGRGIRISNSRHTVNYGSDLTGGGDLFVGNE      1 - 70
KMAMQNLNDRLASYLEKVRTLEQSNSKLEVQIKQWYETNAPRAGRDYSAYYRQIEELRSQIKDAQLQNAR     71 - 140
CVLQIDNAKLAAEDFRLKYETERGIRLTVEADLQGLNKVFDDLTLHKTDLEIQIEELNKDLALLKKEHQE    141 - 210
EVDGLHKHLGNTVNVEVDAAPGLNLGVIMNEMRQKYEVMAQKNLQEAKEQFERQTAVLQQQVTVNTEELK    211 - 280
GTEVQLTELRRTSQSLEIELQSHLSMKESLEHTLEETKARYSSQLANLQSLLSSLEAQLMQIRSNMERQN    281 - 350
NEYHILLDIKTRLEQEIATYRRLLEGEDVKTTEYQLSTLEERDIKKTRKIKTVVQEVVDGKVVSSEVKEV    351 - 420
EENI                                                                      421 - 424
//

Text Mined References (92)

PMID Year Title