Property Summary

NCBI Gene PubMed Count 84
Grant Count 805
R01 Count 257
Funding $154,876,485.81
PubMed Score 532.94
PubTator Score 5693.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Barrett's esophagus 4.400 0.033
intraductal papillary-mucinous carcinoma... 3.600 0.026
colon cancer -2.400 0.000
interstitial cystitis -3.500 0.003
psoriasis -1.300 0.000

Synonym

Accession P35900 B2R6W7
Symbols K20
CD20
CK20
CK-20
KRT21

Gene

Gene RIF (72)

PMID Text
26670478 K20 expression was detected in 6 of 75 patients with triple-negative carcinoma
26227487 Circulating tumor cell CK20 and survivin expression may effectively predict overall survival in metastic colorectal cancer patients receiving chemotherapy.
26125781 During postoperative follow-up, serum negative CK20 patients had significantly higher 3-year survival rates than serum positive CK20 patients.
25854400 Patients with any EGFR, CK19, CK20 or survinin positivity in their peripheral blood obtain less benefit from radiotherapy.
25643514 The present study confirmed that CK14, but not CK20 or CK7, is expressed in urothelial carcinoma with squamous differentiation and squamous cell carcinoma of the urinary bladder.
25528628 Our data show that inclusion of CK20 as a biomarker efficiently improves the detection of CTCs in colorectal cancer patients
25081540 Immunostaining of CDX2 and CK20 provides beneficial information if considering whether to perform an endoscopic papillectomy (EP).
24901475 Case Report: Merkel cell carcinma that initially demonstrated cytokeratin 20 positivity but lost expression in subsequent brain metastases.
24403457 High cytokeratin 20 expression is associated with invasive histological phenotype in poorly differentiated colorectal adenocarcinoma.
24025523 The CDX2/CK20 phenotype defines a distinct subgroup of colorectal cancers with microsatellite instability and poor differentiation
More...

AA Sequence

MDFSRRSFHRSLSSSLQAPVVSTVGMQRLGTTPSVYGGAGGRGIRISNSRHTVNYGSDLTGGGDLFVGNE      1 - 70
KMAMQNLNDRLASYLEKVRTLEQSNSKLEVQIKQWYETNAPRAGRDYSAYYRQIEELRSQIKDAQLQNAR     71 - 140
CVLQIDNAKLAAEDFRLKYETERGIRLTVEADLQGLNKVFDDLTLHKTDLEIQIEELNKDLALLKKEHQE    141 - 210
EVDGLHKHLGNTVNVEVDAAPGLNLGVIMNEMRQKYEVMAQKNLQEAKEQFERQTAVLQQQVTVNTEELK    211 - 280
GTEVQLTELRRTSQSLEIELQSHLSMKESLEHTLEETKARYSSQLANLQSLLSSLEAQLMQIRSNMERQN    281 - 350
NEYHILLDIKTRLEQEIATYRRLLEGEDVKTTEYQLSTLEERDIKKTRKIKTVVQEVVDGKVVSSEVKEV    351 - 420
EENI                                                                      421 - 424
//

Text Mined References (87)

PMID Year Title
26670478 2016 Aberrant keratin 7 and 20 expression in triple-negative carcinoma of the breast.
26227487 2015 Cytokeratin-20 and Survivin-Expressing Circulating Tumor Cells Predict Survival in Metastatic Colorectal Cancer Patients by a Combined Immunomagnetic qRT-PCR Approach.
26125781 2015 Predictive value of CK20 in evaluating the efficacy of treatment and prognosis after surgery for colorectal cancer.
25854400 2015 Effects of EGFR, CK19, CK20 and Survinin gene expression on radiotherapy results in patients with locally advanced head and neck cancer.
25643514 2014 Expression of cytokeratin 7, 20, 14 in urothelial carcinoma and squamous cell carcinoma of the Egyprian urinary bladder cancer.
25528628 2015 Cytokeratin 20 improves the detection of circulating tumor cells in patients with colorectal cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25081540 2014 Comparison between the location and the histomorphological/immunohistochemical characteristics of noninvasive neoplasms of the ampulla of Vater.
24901475 2014 Loss of cytokeratin 20 and acquisition of thyroid transcription factor-1 expression in a merkel cell carcinoma metastasis to the brain.
24403457 2014 Expression of cytokeratin 20 indicates invasive histological phenotype in poorly differentiated colorectal adenocarcinoma.
More...