Property Summary

NCBI Gene PubMed Count 190
Grant Count 167
R01 Count 98
Funding $21,238,535.46
PubMed Score 671.78
PubTator Score 3183.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
hepatocellular carcinoma -1.400 0.000
malignant mesothelioma 1.200 0.000
medulloblastoma, large-cell -1.100 0.000
lung cancer -1.500 0.012
group 4 medulloblastoma -1.200 0.001
non primary Sjogren syndrome sicca 1.200 0.020
psoriasis -1.200 0.000
acute myeloid leukemia 1.300 0.002

Synonym

Accession P35638 F8VS99 DDIT-3
Symbols CHOP
CEBPZ
CHOP10
CHOP-10
GADD153

Gene

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1357 screening 0 / 0 / 11 Determination of inhibition of thapsigargin-initiated CHOP protein induction in ER stress signaling.

Gene RIF (153)

PMID Text
26865464 FUS-DDIT3 is uniquely regulated at the transcriptional as well as the post-translational level and that its expression level is important for myxoid liposarcoma tumour development.
26504039 Up-regulation of CHOP is associated with Pancreatic Neuroendocrine Tumors.
26486079 Data show CGK733 induced microtubule associated protein LC3B formation upstream of AMP-activated protein kinase and protein kinase RNA-like endoplasmic reticulum kinase/CCAAT-enhancer-binding protein homologous protein pathways and p21 Cip1 expression.
26384350 Data suggest that HOXA-AS2 could be an oncogene for GC partly through suppressing P21, PLK3, and DDIT3 expression.
26259235 CGK733-induced intracellular calcium sequestration in pancreatic tumor cells is correlated with the PERK/CHOP signaling pathway and may also be involved in the dysregulations of calcium-binding proteins.
26174226 the C/EBPD binding site is required for RU486-mediated activation of the CHOP promoter.
26125799 Combined administration inhibited the cells most potently and time-dependently, decreased the expression of HO-1, and significantly increased the expression of ATF4, CHOP, and Ire-1 proteins expression levels
26090483 Blockage of PERK signaling expression by siRNA not only significantly reduced the expression of CHOP.
25770212 DDIT3 and KAT2A cooperatively up-regulate TNFRSF10A and TNFRSF10B.
25643991 These data show that altered/impaired expression of mtDNA induces CHOP-10 expression in a signaling pathway that depends on the eIF2alpha/ATF4 axis of the integrated stress response rather than on the mitochondrial unfolded protein response.
More...

AA Sequence

MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEP      1 - 70
AEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENER     71 - 140
LKQEIERLTREVEATRRALIDRMVNLHQA                                             141 - 169
//

Text Mined References (193)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26865464 2016 Regulatory mechanisms, expression levels and proliferation effects of the FUS-DDIT3 fusion oncogene in liposarcoma.
26504039 2015 Endoplasmic Reticulum Stress in Pancreatic Neuroendocrine Tumors is Linked to Clinicopathological Parameters and Possible Epigenetic Regulations.
26486079 2015 CGK733-induced LC3 II formation is positively associated with the expression of cyclin-dependent kinase inhibitor p21Waf1/Cip1 through modulation of the AMPK and PERK/CHOP signaling pathways.
26384350 2015 Long noncoding RNA HOXA-AS2 promotes gastric cancer proliferation by epigenetically silencing P21/PLK3/DDIT3 expression.
26259235 2015 PERK/CHOP contributes to the CGK733-induced vesicular calcium sequestration which is accompanied by non-apoptotic cell death.
26174226 2016 RU486 Induces Pro-Apoptotic Endoplasmic Reticulum Stress Through the Induction of CHOP Expression by Enhancing C/EBP? Expression in Human Renal Carcinoma Caki Cells.
26125799 2015 Proapoptotic effects of heme oxygenase-1 inhibitor on Kasumi-1 cells via the ATF4/CHOP/Ire-1? pathway.
26090483 2015 Induction of Apoptosis Coupled to Endoplasmic Reticulum Stress through Regulation of CHOP and JNK in Bone Marrow Mesenchymal Stem Cells from Patients with Systemic Lupus Erythematosus.
25770212 2015 DDIT3 and KAT2A Proteins Regulate TNFRSF10A and TNFRSF10B Expression in Endoplasmic Reticulum Stress-mediated Apoptosis in Human Lung Cancer Cells.
More...