Property Summary

Ligand Count 8
NCBI Gene PubMed Count 214
PubMed Score 736.04
PubTator Score 3183.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
acute myeloid leukemia 1.300 2.3e-03
group 4 medulloblastoma -1.200 8.7e-04
hepatocellular carcinoma -1.400 6.3e-06
lung cancer -1.500 1.2e-02
malignant mesothelioma 1.200 2.8e-05
medulloblastoma, large-cell -1.100 3.0e-04
non primary Sjogren syndrome sicca 1.200 2.0e-02
psoriasis -1.200 3.7e-11

 IMPC Phenotype (1)

Gene RIF (176)

AA Sequence

MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEP      1 - 70
AEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENER     71 - 140
LKQEIERLTREVEATRRALIDRMVNLHQA                                             141 - 169
//

Text Mined References (217)

PMID Year Title