Property Summary

NCBI Gene PubMed Count 418
Grant Count 263
R01 Count 148
Funding $44,672,839.25
PubMed Score 1224.42
PubTator Score 661.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Rheumatoid Arthritis -1.100 0.048
Multiple myeloma 1.201 0.005
ependymoma 1.400 0.032
atypical teratoid / rhabdoid tumor 1.100 0.000
glioblastoma 1.300 0.002
medulloblastoma, large-cell 1.600 0.001
active Crohn's disease -1.743 0.031
ulcerative colitis -1.900 0.000
ovarian cancer 1.700 0.000
Down syndrome 1.500 0.002
dermatomyositis -1.100 0.003

Synonym

Accession P35613 A6NJW1 D3YLG5 Q7Z796 Q8IZL7
Symbols OK
5F7
TCSF
CD147
EMMPRIN

Gene

BSG

PDB

3B5H   3I84   3I85   3QQN   3QR2   4U0Q  

Gene RIF (382)

PMID Text
26779534 MCT1 expression was not clearly associated with overall or disease-free survival. MCT4 and CD147 expression correlate with worse prognosis across many cancer types. These results warrant further investigation of these associations
26773532 EMMPRIN, MMP8, hyaluronan, beta-defensing-2, and neutrophil gelatinase-associated lipocalin (NGAL) are elevated in women with vaginal inflammation
26729804 our data show that CD147 interacts via its immunomodulatory domains with PMCA4 to bypass TCR proximal signaling and inhibit IL-2 expression.
26689432 The cHAb18 was produced in rNDV-18HL-infected cells followed by releasing into the supernatant by cytolysis. The rNDV-18HL-encoded cHAb18 antibody kept affinity for CD147 and showed inhibiting the migration and invasion of hepatocellular carcinoma cells
26675551 High CD147 expression was significantly associated with tumorigenicity of Kaposi's sarcoma-associated herpesvirus infected endothelial cells.
26634540 malignant proliferation of human breast cancer MCF-7 cells was significantly inhibited after silencing of the EMMPRIN gene using RNAi, and cells in the G1/G0 and G2/M phases were increased.
26604323 CD147 also participates in inflammation, nutrient and drug transporter activity, microbial pathology and developmental processes
26530384 The authors identified two new human proteins that interact with Ehrlichia chaffeensis EtpE-C: CD147 and heterogeneous nuclear ribonucleoprotein K (hnRNP-K).
26498680 these results reveal that CD147 functions as a critical regulator of endoplasmic reticulum -dependent [Ca2+]i oscillations to promote oncogenic progression in hepatocellular carcinoma
26496775 CD147 is increased in hepatocellular carcinoma cells under starvation and reduces cell death through upregulating mTOR in vitro.
More...

AA Sequence

MAAALFVLLGFALLGTHGASGAAGFVQAPLSQQRWVGGSVELHCEAVGSPVPEIQWWFEGQGPNDTCSQL      1 - 70
WDGARLDRVHIHATYHQHAASTISIDTLVEEDTGTYECRASNDPDRNHLTRAPRVKWVRAQAVVLVLEPG     71 - 140
TVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPM    141 - 210
GTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQ    211 - 280
GRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRK    281 - 350
PEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS                                       351 - 385
//

Text Mined References (427)

PMID Year Title
26779534 2015 Prognostic Indications of Elevated MCT4 and CD147 across Cancer Types: A Meta-Analysis.
26773532 2016 Vaginal Inflammation: Association between Leukocyte Concentration and Levels of Immune Mediators.
26729804 2016 Association of CD147 and Calcium Exporter PMCA4 Uncouples IL-2 Expression from Early TCR Signaling.
26689432 2015 Oncolytic Newcastle disease virus expressing chimeric antibody enhanced anti-tumor efficacy in orthotopic hepatoma-bearing mice.
26675551 2016 CD147 and downstream ADAMTSs promote the tumorigenicity of Kaposi's sarcoma-associated herpesvirus infected endothelial cells.
26634540 2015 Effect of specific silencing of EMMPRIN on the growth and cell cycle distribution of MCF-7 breast cancer cells.
26604323 2015 How, with whom and when: an overview of CD147-mediated regulatory networks influencing matrix metalloproteinase activity.
26530384 2015 EtpE Binding to DNase X Induces Ehrlichial Entry via CD147 and hnRNP-K Recruitment, Followed by Mobilization of N-WASP and Actin.
26498680 2015 CD147 reinforces [Ca2+]i oscillations and promotes oncogenic progression in hepatocellular carcinoma.
26496775 2016 CD147 is increased in HCC cells under starvation and reduces cell death through upregulating p-mTOR in vitro.
More...