Property Summary

NCBI Gene PubMed Count 455
PubMed Score 1335.41
PubTator Score 661.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
active Crohn's disease -1.743 3.1e-02
active ulcerative colitis -1.365 1.8e-02
atypical teratoid / rhabdoid tumor 1.100 3.8e-04
dermatomyositis -1.100 2.7e-03
Down syndrome 1.500 2.0e-03
ependymoma 1.400 3.2e-02
glioblastoma 1.300 2.2e-03
medulloblastoma, large-cell 1.600 6.5e-04
Multiple myeloma 1.201 5.1e-03
ovarian cancer -1.300 2.5e-06
Rheumatoid arthritis -1.100 4.8e-02

 GWAS Trait (1)

Gene RIF (416)

AA Sequence

MAAALFVLLGFALLGTHGASGAAGFVQAPLSQQRWVGGSVELHCEAVGSPVPEIQWWFEGQGPNDTCSQL      1 - 70
WDGARLDRVHIHATYHQHAASTISIDTLVEEDTGTYECRASNDPDRNHLTRAPRVKWVRAQAVVLVLEPG     71 - 140
TVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPM    141 - 210
GTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQ    211 - 280
GRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRK    281 - 350
PEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS                                       351 - 385
//

Text Mined References (464)

PMID Year Title