Property Summary

NCBI Gene PubMed Count 53
PubMed Score 104.44
PubTator Score 37.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
oligodendroglioma 2849 1.78973585976467E-12
pilocytic astrocytoma 3086 7.72894779936046E-12
pediatric high grade glioma 2712 8.50691621966782E-9
ependymoma 2514 2.01003576570062E-8
osteosarcoma 7933 1.16415157272652E-7
glioblastoma 5572 1.8023462801541E-7
group 3 medulloblastoma 2254 9.50522676825376E-7
medulloblastoma, large-cell 6234 4.92217092192157E-5
atypical teratoid / rhabdoid tumor 4369 1.4438520304328E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 3.595951078899E-4
lung cancer 4473 7.5163410202488E-4
colon cancer 1475 8.05907457487777E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 8.23396619796699E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00489476520700818
primitive neuroectodermal tumor 3031 0.00915287304082337
astrocytic glioma 2241 0.012458126477838
subependymal giant cell astrocytoma 2287 0.0433090032468716
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Testicular cancer 24 0.0 1.0

Expression

Gene RIF (30)

PMID Text
26723519 Study evaluated effects of ADD genetic variability on cognitive functions in a sample of patients with schizophrenia, known to show a wide and heterogeneous neuropsychological deficit and found that ADD2 C1797T polymorphism showed diffuse effects on almost every cognitive domain.
26045217 ADD2 and NCX1 variants influence the risk and the clinical features of systemic lupus erythematosus and lupus nephritis.
25425738 Taken together, these results show that beta-adducin is a pivotal lipid raft-associated protein in PSGL-1-mediated neutrophil rolling on P-selectin.
24129186 chorein interacts with beta-adducin and beta-actin.
21606488 phosphorylation of beta-adducin by GSK3 promotes efficient neurite outgrowth in neurons.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19838659 ALPHA AND BETA ADDUCIN POLYMORPHISMS AFFECT DECLINE OF RENAL FUNCTION IN HUMAN IGA NEPHROPATHY.
19838659 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
More...

AA Sequence

MSEETVPEAASPPPPQGQPYFDRFSEDDPEYMRLRNRAADLRQDFNLMEQKKRVTMILQSPSFREELEGL      1 - 70
IQEQMKKGNNSSNIWALRQIADFMASTSHAVFPTSSMNVSMMTPINDLHTADSLNLAKGERLMRCKISSV     71 - 140
YRLLDLYGWAQLSDTYVTLRVSKEQDHFLISPKGVSCSEVTASSLIKVNILGEVVEKGSSCFPVDTTGFC    141 - 210
LHSAIYAARPDVRCIIHLHTPATAAVSAMKWGLLPVSHNALLVGDMAYYDFNGEMEQEADRINLQKCLGP    211 - 280
TCKILVLRNHGVVALGDTVEEAFYKIFHLQAACEIQVSALSSAGGVENLILLEQEKHRPHEVGSVQWAGS    281 - 350
TFGPMQKSRLGEHEFEALMRMLDNLGYRTGYTYRHPFVQEKTKHKSEVEIPATVTAFVFEEDGAPVPALR    351 - 420
QHAQKQQKEKTRWLNTPNTYLRVNVADEVQRSMGSPRPKTTWMKADEVEKSSSGMPIRIENPNQFVPLYT    421 - 490
DPQEVLEMRNKIREQNRQDVKSAGPQSQLLASVIAEKSRSPSTESQLMSKGDEDTKDDSEETVPNPFSQL    491 - 560
TDQELEEYKKEVERKKLELDGEKETAPEEPGSPAKSAPASPVQSPAKEAETKSPLVSPSKSLEEGTKKTE    561 - 630
TSKAATTEPETTQPEGVVVNGREEEQTAEEILSKGLSQMTTSADTDVDTSKDKTESVTSGPMSPEGSPSK    631 - 700
SPSKKKKKFRTPSFLKKSKKKEKVES                                                701 - 726
//

Text Mined References (58)

PMID Year Title
26723519 2016 ADDing a piece to the puzzle of cognition in schizophrenia.
26045217 2015 Beta-adducin and sodium-calcium exchanger 1 gene variants are associated with systemic lupus erythematosus and lupus nephritis.
25425738 2015 Lipid raft-associated ?-adducin is required for PSGL-1-mediated neutrophil rolling on P-selectin.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129186 2013 Chorein, the protein responsible for chorea-acanthocytosis, interacts with ?-adducin and ?-actin.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
21606488 2011 Bioinformatic prediction and confirmation of beta-adducin as a novel substrate of glycogen synthase kinase 3.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...