Property Summary

NCBI Gene PubMed Count 54
PubMed Score 106.54
PubTator Score 37.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.600 2.7e-05
astrocytic glioma -1.600 1.2e-02
Astrocytoma, Pilocytic -2.200 4.3e-12
atypical teratoid / rhabdoid tumor -2.400 1.4e-04
colon cancer -1.200 8.1e-04
ependymoma -1.600 3.7e-02
glioblastoma -1.700 6.5e-08
group 3 medulloblastoma 2.600 9.5e-07
intraductal papillary-mucinous adenoma (... -1.700 3.6e-04
intraductal papillary-mucinous carcinoma... -1.600 8.2e-04
intraductal papillary-mucinous neoplasm ... -1.800 4.9e-03
lung cancer 2.500 7.5e-04
medulloblastoma, large-cell -1.500 4.9e-05
oligodendroglioma -1.100 1.8e-12
osteosarcoma -4.642 1.2e-07
primitive neuroectodermal tumor -1.400 2.1e-02
subependymal giant cell astrocytoma -2.039 4.3e-02

Protein-protein Interaction (6)

Gene RIF (31)

AA Sequence

MSEETVPEAASPPPPQGQPYFDRFSEDDPEYMRLRNRAADLRQDFNLMEQKKRVTMILQSPSFREELEGL      1 - 70
IQEQMKKGNNSSNIWALRQIADFMASTSHAVFPTSSMNVSMMTPINDLHTADSLNLAKGERLMRCKISSV     71 - 140
YRLLDLYGWAQLSDTYVTLRVSKEQDHFLISPKGVSCSEVTASSLIKVNILGEVVEKGSSCFPVDTTGFC    141 - 210
LHSAIYAARPDVRCIIHLHTPATAAVSAMKWGLLPVSHNALLVGDMAYYDFNGEMEQEADRINLQKCLGP    211 - 280
TCKILVLRNHGVVALGDTVEEAFYKIFHLQAACEIQVSALSSAGGVENLILLEQEKHRPHEVGSVQWAGS    281 - 350
TFGPMQKSRLGEHEFEALMRMLDNLGYRTGYTYRHPFVQEKTKHKSEVEIPATVTAFVFEEDGAPVPALR    351 - 420
QHAQKQQKEKTRWLNTPNTYLRVNVADEVQRSMGSPRPKTTWMKADEVEKSSSGMPIRIENPNQFVPLYT    421 - 490
DPQEVLEMRNKIREQNRQDVKSAGPQSQLLASVIAEKSRSPSTESQLMSKGDEDTKDDSEETVPNPFSQL    491 - 560
TDQELEEYKKEVERKKLELDGEKETAPEEPGSPAKSAPASPVQSPAKEAETKSPLVSPSKSLEEGTKKTE    561 - 630
TSKAATTEPETTQPEGVVVNGREEEQTAEEILSKGLSQMTTSADTDVDTSKDKTESVTSGPMSPEGSPSK    631 - 700
SPSKKKKKFRTPSFLKKSKKKEKVES                                                701 - 726
//

Text Mined References (59)

PMID Year Title