Property Summary

NCBI Gene PubMed Count 55
Grant Count 64
R01 Count 37
Funding $12,793,974.61
PubMed Score 77.92
PubTator Score 49.51

Knowledge Summary

Patent

No data available

Expression

Gene RIF (34)

PMID Text
25976449 The THBS4 A387P polymorphism was associated with coronary artery disease in American population.
24941943 Tsp4 functions as an ECM scaffold at myotendinous junctions, with potential therapeutic uses in tendon strengthening and repair
23942617 THBS4 expression in breast cancer-associated extracellular matrix contributes to the activated stromal response exhibited during tumour progression
23420636 the balancing selection target in THBS4 is likely represented by one or more variants that regulate tissue-specific and sex-specific gene expression
22745497 The results of thid study suggested that injury-induced spinal TSP4 may contribute to spinal presynaptic hypersensitivity and neuropathic pain states.
22011848 genetic polymorphism predicts cardiovascular risk in postinfarction patients with high HDL cholesterol and C-reactive protein levels
21701537 Identify THBS4 as a powerful marker for diffuse-type gastric adenocarcinomas and to provide an initial characterization of its expression in the course of this disease.
20846368 High THBS4 methylation resulting in inactivation of the gene is associated with colorectal cancer.
20673868 Observational study of gene-disease association. (HuGE Navigator)
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MLAPRGAAVLLLHLVLQRWLAAGAQATPQVFDLLPSSSQRLNPGALLPVLTDPALNDLYVISTFKLQTKS      1 - 70
SATIFGLYSSTDNSKYFEFTVMGRLNKAILRYLKNDGKVHLVVFNNLQLADGRRHRILLRLSNLQRGAGS     71 - 140
LELYLDCIQVDSVHNLPRAFAGPSQKPETIELRTFQRKPQDFLEELKLVVRGSLFQVASLQDCFLQQSEP    141 - 210
LAATGTGDFNRQFLGQMTQLNQLLGEVKDLLRQQVKETSFLRNTIAECQACGPLKFQSPTPSTVVPPAPP    211 - 280
APPTRPPRRCDSNPCFRGVQCTDSRDGFQCGPCPEGYTGNGITCIDVDECKYHPCYPGVHCINLSPGFRC    281 - 350
DACPVGFTGPMVQGVGISFAKSNKQVCTDIDECRNGACVPNSICVNTLGSYRCGPCKPGYTGDQIRGCKA    351 - 420
ERNCRNPELNPCSVNAQCIEERQGDVTCVCGVGWAGDGYICGKDVDIDSYPDEELPCSARNCKKDNCKYV    421 - 490
PNSGQEDADRDGIGDACDEDADGDGILNEQDNCVLIHNVDQRNSDKDIFGDACDNCLSVLNNDQKDTDGD    491 - 560
GRGDACDDDMDGDGIKNILDNCPKFPNRDQRDKDGDGVGDACDSCPDVSNPNQSDVDNDLVGDSCDTNQD    561 - 630
SDGDGHQDSTDNCPTVINSAQLDTDKDGIGDECDDDDDNDGIPDLVPPGPDNCRLVPNPAQEDSNSDGVG    631 - 700
DICESDFDQDQVIDRIDVCPENAEVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLA    701 - 770
VGYTAFNGVDFEGTFHVNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVK    771 - 840
SKTGPGEHLRNSLWHTGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVRFYEGSELVADSGV    841 - 910
TIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQTQNFDRFDN                       911 - 961
//

Text Mined References (59)

PMID Year Title
25976449 2015 Association between single nucleotide polymorphisms in thrombospondins genes and coronary artery disease: A meta-analysis.
25436638 2014 Genetic variants associated with serum thyroid stimulating hormone (TSH) levels in European Americans and African Americans from the eMERGE Network.
25234833 2014 The possible involvement of skin dryness on alterations of the dermal matrix.
24941943 2014 Thrombospondin-4 controls matrix assembly during development and repair of myotendinous junctions.
24787432 2014 Targeted proteomics pipeline reveals potential biomarkers for the diagnosis of metastatic lung cancer in pleural effusion.
23942617 2013 Thrombospondin-4 expression is activated during the stromal response to invasive breast cancer.
23892609 2013 Thrombospondins: old players, new games.
23874812 2013 Plasminogen activator inhibitor-2 polymorphism associates with recurrent coronary event risk in patients with high HDL and C-reactive protein levels.
23801863 2013 Gastric precancerous lesions are associated with gene variants in Helicobacter pylori-susceptible ethnic Malays.
23637781 2013 Elucidating novel serum biomarkers associated with pulmonary tuberculosis treatment.
More...