Property Summary

NCBI Gene PubMed Count 44
PubMed Score 13.70
PubTator Score 9.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adrenocortical carcinoma 1.560 3.0e-06
atypical teratoid/rhabdoid tumor 1.100 3.5e-05
glioblastoma 1.200 1.3e-05
group 3 medulloblastoma 2.100 2.0e-05
lung cancer 1.900 1.2e-04
malignant mesothelioma 1.900 7.0e-08
medulloblastoma, large-cell 1.300 7.9e-04
nasopharyngeal carcinoma 1.200 4.9e-06
non-small cell lung cancer 2.648 1.0e-26
osteosarcoma -1.674 5.2e-03
ovarian cancer 1.500 1.1e-03
primitive neuroectodermal tumor 1.200 7.2e-04

Protein-protein Interaction (13)

Gene RIF (9)

AA Sequence

MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGAD      1 - 70
LPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVREKVKNFAQLTVSGSRSDGKP     71 - 140
CPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQQR    141 - 210
LLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAA    211 - 280
CQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLIS    281 - 350
LCATVMQQLSQNC                                                             351 - 363
//

Text Mined References (51)

PMID Year Title