Property Summary

NCBI Gene PubMed Count 43
PubMed Score 12.98
PubTator Score 9.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 1.900 0.000
glioblastoma 1.400 0.042
osteosarcoma -1.674 0.005
group 3 medulloblastoma 2.100 0.000
medulloblastoma, large-cell 1.300 0.001
primitive neuroectodermal tumor 1.200 0.001
adrenocortical carcinoma 1.560 0.000
non-small cell lung cancer 2.648 0.000
lung cancer 2.600 0.000
atypical teratoid/rhabdoid tumor 1.100 0.000
nasopharyngeal carcinoma 1.200 0.000
ovarian cancer 1.500 0.001

Synonym

Accession P35249 B4DM41 D3DNV2 Q6FHX7
Symbols A1
RFC37

Gene

Gene RIF (8)

PMID Text
25407051 RFC4 is frequently overexpressed in CRC, and is associated with tumor progression and worse survival outcome. This might be attributed to the regulation of CRC cell proliferation and cell cycle arrest by RFC4
23166591 Expression of HIV-1 Tat downregulates the abundance of replication factor C, subunit 4 (RFC4, 37kDa) in the nucleoli of Jurkat T-cells
20574454 Observational study of gene-disease association. (HuGE Navigator)
20522537 Observational study of gene-disease association. (HuGE Navigator)
20226869 Observational study of gene-disease association. (HuGE Navigator)
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18492021 The knockdown of endogenous replication factor C4 decreases the growth and enhances the chemosensitivity of hepatocellular carcinoma cells.
9121429 Expression of HIV-1 Tat downregulates the abundance of replication factor C, subunit 4 (RFC4, 37kDa) in the nucleoli of Jurkat T-cells

AA Sequence

MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGAD      1 - 70
LPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVREKVKNFAQLTVSGSRSDGKP     71 - 140
CPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQQR    141 - 210
LLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAA    211 - 280
CQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLIS    281 - 350
LCATVMQQLSQNC                                                             351 - 363
//

Text Mined References (50)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25407051 2014 Levels of human replication factor C4, a clamp loader, correlate with tumor progression and predict the prognosis for colorectal cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22703881 2012 Genetic associations for activated partial thromboplastin time and prothrombin time, their gene expression profiles, and risk of coronary artery disease.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
21150319 2010 Proteomic profiling of Myc-associated proteins.
20574454 2010 Polymorphisms in the base excision repair pathway and graft-versus-host disease.
More...