Property Summary

NCBI Gene PubMed Count 229
Grant Count 297
R01 Count 159
Funding $44,386,834.61
PubMed Score 1456.93
PubTator Score 1171.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma -5.800 0.000
psoriasis -1.500 0.001
osteosarcoma -1.926 0.000
medulloblastoma, large-cell -1.100 0.000
lung cancer 1.100 0.006
breast carcinoma 1.500 0.020
ovarian cancer 1.100 0.000

Gene

NF2

PDB

1H4R   3U8Z   4ZRI   4ZRJ  

Gene RIF (162)

PMID Text
26923924 we demonstrate that NF2 negatively controls the invasiveness of Glioblastoma multiforme through YAP-dependent induction of CYR61/CCN1 and miR-296-3p.
26806348 AMOTL1 Promotes Breast Cancer Progression and Is Antagonized by Merlin
26549232 Together our results uncover miRNAs as yet another negative mechanism controlling Merlin tumor suppressor functions.
26493618 homozygous deletions in CDKN2A and hemizygous loss of NF2 as detected by fluorescence in situ hybridization would confer a poor clinical outcome and may guide future treatment decisions for patients with peritoneal mesothelioma.
26483206 findings demonstrated that Merlin critically regulated pancreatic cancer pathogenesis by suppressing FOXM1/beta-catenin signaling
26443326 (Delta2-4)Merlin variant disrupts the normal function of Merlin and promotes hepatocellular carcinoma metastasis.
26418719 Loss of Nf2 and Cdkn2a/b have synergistic effects with PDGF-B overexpression promoting meningioma malignant transformation.
26359368 NF2/merlin inactivation augments mutant RAS signaling by promoting YAP/TEAD-driven transcription of oncogenic and wild-type RAS, resulting in greater MAPK output and increased sensitivity to MEK inhibitors.
26045165 angiomotin and Merlin respectively interface cortical actin filaments and core kinases in Hippo signaling
25965831 Stusies indicate that monosomy 22, which is often associated with mutations of the neurofibromin 2 (NF2) gene, has emerged as the most frequent alteration of meningiomas.
More...

AA Sequence

MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKD      1 - 70
TVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVL     71 - 140
LASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKI    141 - 210
AQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKI    211 - 280
DVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAE    281 - 350
RTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTE    351 - 420
EEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEIATKPTYPPMNPIPAP    421 - 490
LPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDI    491 - 560
LHNENSDRGGSSKHNTIKKLTLQSAKSRVAFFEEL                                       561 - 595
//

Text Mined References (239)

PMID Year Title
26923924 2016 Neurofibromatosis 2 (NF2) controls the invasiveness of glioblastoma through YAP-dependent expression of CYR61/CCN1 and miR-296-3p.
26806348 2016 AMOTL1 Promotes Breast Cancer Progression and Is Antagonized by Merlin.
26549232 2015 Merlin negative regulation by miR-146a promotes cell transformation.
26493618 2016 The prognostic significance of BAP1, NF2, and CDKN2A in malignant peritoneal mesothelioma.
26483206 2015 Merlin/NF2 Suppresses Pancreatic Tumor Growth and Metastasis by Attenuating the FOXM1-Mediated Wnt/?-Catenin Signaling.
26443326 2015 A splicing variant of Merlin promotes metastasis in hepatocellular carcinoma.
26418719 2015 PDGF activation in PGDS-positive arachnoid cells induces meningioma formation in mice promoting tumor progression in combination with Nf2 and Cdkn2ab loss.
26359368 2015 NF2 Loss Promotes Oncogenic RAS-Induced Thyroid Cancers via YAP-Dependent Transactivation of RAS Proteins and Sensitizes Them to MEK Inhibition.
26045165 2015 Angiomotin binding-induced activation of Merlin/NF2 in the Hippo pathway.
25965831 2015 Genetic/molecular alterations of meningiomas and the signaling pathways targeted.
More...