Property Summary

NCBI Gene PubMed Count 247
PubMed Score 1539.99
PubTator Score 1171.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count P-value
osteosarcoma 7950 1.4e-09
ovarian cancer 8520 2.0e-04
medulloblastoma, large-cell 6241 3.2e-04
psoriasis 6694 1.4e-03
lung cancer 4740 6.0e-03
breast carcinoma 1638 2.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Connective tissue cancer 10 0.0 1.3
Kidney cancer 2613 0.0 0.9
Disease Target Count Z-score Confidence
Neurofibromatosis 40 8.271 4.0
Neurilemmomatosis 5 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2499 4.813 2.4
Disease Target Count Z-score Confidence
Tanycytic ependymoma 3 4.077 2.0
Benign meningioma 6 3.85 1.9

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma -5.500 4.8e-07
breast carcinoma 1.500 2.0e-02
lung cancer 1.100 6.0e-03
medulloblastoma, large-cell -1.100 3.2e-04
osteosarcoma -1.926 1.4e-09
ovarian cancer 1.100 2.0e-04
psoriasis -1.500 1.4e-03

 GO Function (1)

Protein-protein Interaction (4)

Gene RIF (180)

AA Sequence

MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKD      1 - 70
TVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVL     71 - 140
LASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKI    141 - 210
AQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKI    211 - 280
DVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAE    281 - 350
RTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTE    351 - 420
EEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEIATKPTYPPMNPIPAP    421 - 490
LPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDI    491 - 560
LHNENSDRGGSSKHNTIKKLTLQSAKSRVAFFEEL                                       561 - 595
//

Text Mined References (257)

PMID Year Title