Property Summary

NCBI Gene PubMed Count 16
PubMed Score 14.11
PubTator Score 9.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Infarction, Middle Cerebral Artery 33 0.0 0.0
Disease Target Count P-value
lung adenocarcinoma 2716 1.9e-06
malignant mesothelioma 3232 3.4e-04

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma 2.300 1.9e-06
malignant mesothelioma 1.300 3.4e-04

Gene RIF (5)

AA Sequence

METPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFK      1 - 70
EYSVFLTMLCMAYNDFFLEDNK                                                     71 - 92
//

Text Mined References (17)

PMID Year Title