Property Summary

NCBI Gene PubMed Count 14
Grant Count 3
Funding $19,232.5
PubMed Score 13.18
PubTator Score 9.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
lung adenocarcinoma 2.300 0.000

Synonym

Accession P33763 Q52LE7 Q5RHS3
Symbols S100D

Gene

PDB

2KAX   2KAY   4DIR  

Gene RIF (3)

PMID Text
19601998 Observational study of gene-disease association. (HuGE Navigator)
19536568 Homodimeric solution structures of S100A5 in both apo & Ca(II)-loaded forms were obtained & show conformational rearrangement on Ca binding. Also, large mobility was observed in hinge loop of apo-S100A5; this mobility was not quenched in Ca form.
12645008 Strongly expressed at 12 weeks gestation in the cells and fibers of the hippocampus, and then decreased with age. In the temporal cortex, detected from 12 weeks onwards, peaked at 20 to 24 weeks, and then decreased with age.

AA Sequence

METPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFK      1 - 70
EYSVFLTMLCMAYNDFFLEDNK                                                     71 - 92
//

Text Mined References (15)

PMID Year Title
19668339 2009 Hippocampal atrophy as a quantitative trait in a genome-wide association study identifying novel susceptibility genes for Alzheimer's disease.
19601998 2009 Variation in genes of the epidermal differentiation complex in German atopic dermatitis patients.
19536568 2009 Solution structure and dynamics of S100A5 in the apo and Ca2+-bound states.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12645008 2003 Differential expression of S100 proteins in the developing human hippocampus and temporal cortex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12118070 2002 S100A13 and S100A6 exhibit distinct translocation pathways in endothelial cells.
11855835 2002 Restricted expression of calcium-binding protein S100A5 in human kidney.
11510959 2001 Development and progression of malignancy in human colon tissues are correlated with expression of specific Ca(2+)-binding S100 proteins.
More...