Property Summary

NCBI Gene PubMed Count 77
Grant Count 81
R01 Count 34
Funding $8,477,167.66
PubMed Score 393.70
PubTator Score 144.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.387 0.001
malignant mesothelioma -1.200 0.000
cutaneous lupus erythematosus 1.100 0.048
osteosarcoma -3.806 0.000
periodontitis 1.300 0.000
lung cancer -1.500 0.000
interstitial cystitis 1.700 0.003
lung carcinoma -2.100 0.000
ovarian cancer 1.900 0.000

Synonym

Accession P32942 Q6PD68 ICAM-3
Symbols CD50
CDW50
ICAM-R

Gene

PDB

1T0P  

Gene RIF (43)

PMID Text
24474251 with larger patient groups and preferably detailed histopathological and clinical evaluations, are needed to explain the severity of ICAM-1, ICAM-2, and ICAM-3 molecules in Barrett's esophagus
24177012 this data clearly indicate that ICAM-3 promotes drug resistance via inhibition of apoptosis.
23775590 ICAM3 acts as recognition receptors in the phagocytosis portals of macrophages for engulfment of apoptotic neutrophils.
23144795 Intercellular adhesion molecule (ICAM)-3 mRNA is upregulated in non-adherent endothelial forming cells.
22479382 Results indicate that the ICAM-3 gene promoter is negatively regulated by RUNX3.
22396536 analysis of activated apoptotic cells induce dendritic cell maturation via engagement of Toll-like receptor 4 (TLR4), dendritic cell-specific intercellular adhesion molecule 3 (ICAM-3)-grabbing nonintegrin (DC-SIGN), and beta2 integrins
22205703 the molecular basis of allergen-induced Th2 cell polarization
22117198 ICAM-3 may be an important adhesion molecule involved in chemotaxis to apoptotic human leukocytes.
21712539 the cross-talk between neutrophils and NK cells is mediated by ICAM-3 and CD11d/CD18, respectively.
21381019 induction of morphological polarization in primary T lymphocytes and Jurkat cells enhances Kidins220/ARMS colocalization with ICAM-3
More...

AA Sequence

MATMVPSVLWPRACWTLLVCCLLTPGVQGQEFLLRVEPQNPVLSAGGSLFVNCSTDCPSSEKIALETSLS      1 - 70
KELVASGMGWAAFNLSNVTGNSRILCSVYCNGSQITGSSNITVYRLPERVELAPLPPWQPVGQNFTLRCQ     71 - 140
VEDGSPRTSLTVVLLRWEEELSRQPAVEEPAEVTATVLASRDDHGAPFSCRTELDMQPQGLGLFVNTSAP    141 - 210
RQLRTFVLPVTPPRLVAPRFLEVETSWPVDCTLDGLFPASEAQVYLALGDQMLNATVMNHGDTLTATATA    211 - 280
TARADQEGAREIVCNVTLGGERREARENLTVFSFLGPIVNLSEPTAHEGSTVTVSCMAGARVQVTLDGVP    281 - 350
AAAPGQPAQLQLNATESDDGRSFFCSATLEVDGEFLHRNSSVQLRVLYGPKIDRATCPQHLKWKDKTRHV    351 - 420
LQCQARGNPYPELRCLKEGSSREVPVGIPFFVNVTHNGTYQCQASSSRGKYTLVVVMDIEAGSSHFVPVF    421 - 490
VAVLLTLGVVTIVLALMYVFREHQRSGSYHVREESTYLPLTSMQPTEAMGEEPSRAE                 491 - 547
//

Text Mined References (83)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24474251 2014 Investigation of intercellular adhesion molecules (ICAMs) gene expressions in patients with Barrett's esophagus.
24177012 2013 ICAM-3 endows anticancer drug resistance against microtubule-damaging agents via activation of the ICAM-3-AKT/ERK-CREB-2 pathway and blockage of apoptosis.
23775590 2013 Novel role of ICAM3 and LFA-1 in the clearance of apoptotic neutrophils by human macrophages.
23144795 2012 Characterization of a distinct population of circulating human non-adherent endothelial forming cells and their recruitment via intercellular adhesion molecule-3.
22479382 2012 RUNX3 regulates intercellular adhesion molecule 3 (ICAM-3) expression during macrophage differentiation and monocyte extravasation.
22396536 2012 Activated apoptotic cells induce dendritic cell maturation via engagement of Toll-like receptor 4 (TLR4), dendritic cell-specific intercellular adhesion molecule 3 (ICAM-3)-grabbing nonintegrin (DC-SIGN), and ?2 integrins.
22205703 2012 Retagging identifies dendritic cell-specific intercellular adhesion molecule-3 (ICAM3)-grabbing non-integrin (DC-SIGN) protein as a novel receptor for a major allergen from house dust mite.
22117198 2012 Apoptotic cell-derived ICAM-3 promotes both macrophage chemoattraction to and tethering of apoptotic cells.
21712539 2011 On the potential involvement of CD11d in co-stimulating the production of interferon-? by natural killer cells upon interaction with neutrophils via intercellular adhesion molecule-3.
More...