Property Summary

NCBI Gene PubMed Count 100
PubMed Score 402.01
PubTator Score 359.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Atopic dermatitis 1.500 1.5e-03
Breast cancer -3.500 1.1e-12
breast carcinoma -1.100 3.3e-09
cystic fibrosis and chronic rhinosinusit... 1.531 4.9e-03
esophageal adenocarcinoma -3.200 2.9e-02
non-small cell lung cancer 3.895 2.3e-12
pancreatic cancer 1.100 3.2e-02
psoriasis 2.300 1.3e-09
spina bifida -1.185 4.0e-02
ulcerative colitis 2.400 1.4e-03
urothelial carcinoma -1.500 7.9e-03

Gene RIF (67)

AA Sequence

MMGLFPRTTGALAIFVVVILVHGELRIETKGQYDEEEMTMQQAKRRQKREWVKFAKPCREGEDNSKRNPI      1 - 70
AKITSDYQATQKITYRISGVGIDQPPFGIFVVDKNTGDINITAIVDREETPSFLITCRALNAQGLDVEKP     71 - 140
LILTVKILDINDNPPVFSQQIFMGEIEENSASNSLVMILNATDADEPNHLNSKIAFKIVSQEPAGTPMFL    141 - 210
LSRNTGEVRTLTNSLDREQASSYRLVVSGADKDGEGLSTQCECNIKVKDVNDNFPMFRDSQYSARIEENI    211 - 280
LSSELLRFQVTDLDEEYTDNWLAVYFFTSGNEGNWFEIQTDPRTNEGILKVVKALDYEQLQSVKLSIAVK    281 - 350
NKAEFHQSVISRYRVQSTPVTIQVINVREGIAFRPASKTFTVQKGISSKKLVDYILGTYQAIDEDTNKAA    351 - 420
SNVKYVMGRNDGGYLMIDSKTAEIKFVKNMNRDSTFIVNKTITAEVLAIDEYTGKTSTGTVYVRVPDFND    421 - 490
NCPTAVLEKDAVCSSSPSVVVSARTLNNRYTGPYTFALEDQPVKLPAVWSITTLNATSALLRAQEQIPPG    491 - 560
VYHISLVLTDSQNNRCEMPRSLTLEVCQCDNRGICGTSYPTTSPGTRYGRPHSGRLGPAAIGLLLLGLLL    561 - 630
LLLAPLLLLTCDCGAGSTGGVTGGFIPVPDGSEGTIHQWGIEGAHPEDKEITNICVPPVTANGADFMESS    631 - 700
EVCTNTYARGTAVEGTSGMEMTTKLGAATESGGAAGFATGTVSGAASGFGAATGVGICSSGQSGTMRTRH    701 - 770
STGGTNKDYADGAISMNFLDSYFSQKAFACAEEDDGQEANDCLLIYDNEGADATGSPVGSVGCCSFIADD    771 - 840
LDDSFLDSLGPKFKKLAEISLGVDGEGKEVQPPSKDSGYGIESCGHPIEVQQTGFVKCQTLSGSQGASAL    841 - 910
STSGSVQPAVSIPDPLQHGNYLVTETYSASGSLVQPSTAGFDPLLTQNVIVTERVICPISSVPGNLAGPT    911 - 980
QLRGSHTMLCTEDPCSRLI                                                       981 - 999
//

Text Mined References (103)

PMID Year Title