Property Summary

NCBI Gene PubMed Count 96
Grant Count 81
R01 Count 55
Funding $7,107,530.55
PubMed Score 379.30
PubTator Score 359.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
urothelial carcinoma -2.100 0.010
esophageal adenocarcinoma -3.200 0.029
psoriasis 3.000 0.000
Atopic dermatitis 1.500 0.001
non-small cell lung cancer 4.449 0.000
pancreatic cancer 1.100 0.032
breast carcinoma -1.100 0.000
spina bifida -2.428 0.027
Breast cancer -3.500 0.000
ulcerative colitis 3.400 0.000
cystic fibrosis and chronic rhinosinusit... 1.531 0.005

Synonym

Accession P32926 A8K2V2
Symbols PVA
CDHF6

Gene

PANTHER Protein Class (2)

PDB

5EQX  

Gene RIF (63)

PMID Text
26469831 Data identify DSG3 as a negative prognostic biomarker in resected pancreatic ductal adenocarcinoma, as high DSG3 expression is associated with poor overall survival and poor tumour-specific survival.
25695683 the Dsg3 epitopes targeted by pathogenic mPV IgG are human specific in mice
25510735 this study directly demonstrates the occurrence of desmoglein 3 molecules outside of desmosomes and reveales that the adhesive properties of these molecules do differ depending on their localization.
25468811 DSG2 and DSG3 might be potential diagnostic markers for squamous cell carcinoma of the lung and DSG3 could be a potential differentiation marker for lung cancer.
25237006 In endometrial luminal epithelium, cadherin 6, desmoglein 2 and plexin b2 were surprisingly found in the apical as well as the lateral membrane domain; their knock-down compromised epithelial integrity.
24820664 Pemphigus vulgaris is characterized by low IgG reactivities to specific self-antigens along with high IgG reactivity to desmoglein 3.
24568510 High DSG3 mRNA expression is associated with esophageal squamous cell carcinoma.
24498201 Dsg3 did not associate with rafts in cells lacking desmosomal proteins.
24328683 Pemphigus vulgaris autoimmune globulin induces Src-dependent tyrosine-phosphorylation of PKP3 and its detachment from DSG3.
23806524 MAC387 and desmoglein-3 are reliable diagnostic markers for supporting the morphologic impression of squamous differentiation in urinary bladder carcinoma.
More...

AA Sequence

MMGLFPRTTGALAIFVVVILVHGELRIETKGQYDEEEMTMQQAKRRQKREWVKFAKPCREGEDNSKRNPI      1 - 70
AKITSDYQATQKITYRISGVGIDQPPFGIFVVDKNTGDINITAIVDREETPSFLITCRALNAQGLDVEKP     71 - 140
LILTVKILDINDNPPVFSQQIFMGEIEENSASNSLVMILNATDADEPNHLNSKIAFKIVSQEPAGTPMFL    141 - 210
LSRNTGEVRTLTNSLDREQASSYRLVVSGADKDGEGLSTQCECNIKVKDVNDNFPMFRDSQYSARIEENI    211 - 280
LSSELLRFQVTDLDEEYTDNWLAVYFFTSGNEGNWFEIQTDPRTNEGILKVVKALDYEQLQSVKLSIAVK    281 - 350
NKAEFHQSVISRYRVQSTPVTIQVINVREGIAFRPASKTFTVQKGISSKKLVDYILGTYQAIDEDTNKAA    351 - 420
SNVKYVMGRNDGGYLMIDSKTAEIKFVKNMNRDSTFIVNKTITAEVLAIDEYTGKTSTGTVYVRVPDFND    421 - 490
NCPTAVLEKDAVCSSSPSVVVSARTLNNRYTGPYTFALEDQPVKLPAVWSITTLNATSALLRAQEQIPPG    491 - 560
VYHISLVLTDSQNNRCEMPRSLTLEVCQCDNRGICGTSYPTTSPGTRYGRPHSGRLGPAAIGLLLLGLLL    561 - 630
LLLAPLLLLTCDCGAGSTGGVTGGFIPVPDGSEGTIHQWGIEGAHPEDKEITNICVPPVTANGADFMESS    631 - 700
EVCTNTYARGTAVEGTSGMEMTTKLGAATESGGAAGFATGTVSGAASGFGAATGVGICSSGQSGTMRTRH    701 - 770
STGGTNKDYADGAISMNFLDSYFSQKAFACAEEDDGQEANDCLLIYDNEGADATGSPVGSVGCCSFIADD    771 - 840
LDDSFLDSLGPKFKKLAEISLGVDGEGKEVQPPSKDSGYGIESCGHPIEVQQTGFVKCQTLSGSQGASAL    841 - 910
STSGSVQPAVSIPDPLQHGNYLVTETYSASGSLVQPSTAGFDPLLTQNVIVTERVICPISSVPGNLAGPT    911 - 980
QLRGSHTMLCTEDPCSRLI                                                       981 - 999
//

Text Mined References (99)

PMID Year Title
26469831 2015 Desmogleins as prognostic biomarkers in resected pancreatic ductal adenocarcinoma.
26422380 2015 Desmoglein 3-Dependent Signaling Regulates Keratinocyte Migration and Wound Healing.
26331291 2016 Atypical pemphigus with immunoglobulin G autoantibodies against desmoglein 3 and desmocollin 3.
26288352 2015 Loss of Desmoglein Binding Is Not Sufficient for Keratinocyte Dissociation in Pemphigus.
26250896 2015 Characterization of desmoglein-3 epitope region peptides as synthetic antigens: analysis of their in vitro T cell stimulating efficacy, cytotoxicity, stability, and their conformational features.
26115704 2015 E-cadherin and Src associate with extradesmosomal Dsg3 and modulate desmosome assembly and adhesion.
25971981 2015 Prevalence of pemphigus and pemphigoid autoantibodies in the general population.
25914046 2015 Low pathogenicity of anti-desmoglein 3 immunoglobulin G autoantibodies contributes to the atypical clinical phenotypes in pemphigus.
25832452 2015 Clues to diagnosis for unusual mucosal pemphigus demonstrating undetectable anti-desmoglein 3 serum antibodies by routine tests.
25754029 2015 Usefulness of specific anti-desmoglein 1 and 3 enzyme-linked immunoassay and indirect immunofluorescence in the evaluation of pemphigus activity.
More...