Property Summary

NCBI Gene PubMed Count 35
Grant Count 160
R01 Count 85
Funding $22,265,119.8
PubMed Score 834.22
PubTator Score 259.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.300 0.016
tuberculosis 1.200 0.000
group 3 medulloblastoma 1.200 0.000
ovarian cancer -2.500 0.000

Synonym

Accession P32856 Q86VW8
Symbols EPM
EPIM
STX2A
STX2B
STX2C

Gene

Gene RIF (11)

PMID Text
24578379 Identify 3 loci associated with circulating tPA levels, the PLAT region, STXBP5, and STX2. Functional studies implicate a novel role for STXBP5 and STX2 in regulating tPA release.
24039787 Epimorphin can revert ovarian cancer cells away from their mesenchymal phenotype and toward an epithelial phenotype.
23219092 epimorphin modulates the signaling pathways mediated by EGFR for epidermal tissue organization
22792389 Genetic variation in STX2 is associated with von Willebrand factor:Ag levels in patients diagnosed with type 1 von Willebrand Disease.
22045676 EPM, secreted by activated stellate cells within stroma, promotes invasion and metastasis of hepatocellular cancer cells by activating MMP-9 expression through the FAK-ERK pathway.
21156930 Genetic variability in STXBP5 and STX2 affects both VWF concentration and activity in young individuals with premature arterial thrombosis.
19129200 Homology with vesicle fusion mediator syntaxin-1a predicts determinants of epimorphin/syntaxin-2 function in mammary epithelial morphogenesis.(
18273050 Inadequate epimorphin elicits an abnormal differentiation response in keratinocytes, and indicate a causal function of the epimorphin signaling gradient for the establishment of differentiated epidermal structure in the skin.
17485553 expression of SNAP-23 and syntaxin-2 on the extracellular surface of the platelet plasma membrane.
15651999 These findings suggest that epimorphin contributes to repair of pulmonary fibrosis in nonspecific interstitial pneumonia, perhaps partly by inducing expression of matrix metalloproteinase 2, which is an important proteolytic factor in lung remodeling.
More...

AA Sequence

MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYVEEVKKNHSIILSAPNPEGKI      1 - 70
KEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLF     71 - 140
RERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKDIMKLETSIRE    141 - 210
LHEMFMDMAMFVETQGEMINNIERNVMNATDYVEHAKEETKKAIKYQSKARRKKWIIIAVSVVLVAIIAL    211 - 280
IIGLSVGK                                                                  281 - 288
//

Text Mined References (36)

PMID Year Title
24578379 2014 Genome-wide association study for circulating tissue plasminogen activator levels and functional follow-up implicates endothelial STXBP5 and STX2.
24039787 2013 Epimorphin-induced MET sensitizes ovarian cancer cells to platinum.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23219092 2013 Extracellular epimorphin modulates epidermal differentiation signals mediated by epidermal growth factor receptor.
22792389 2012 Effect of genetic variation in STXBP5 and STX2 on von Willebrand factor and bleeding phenotype in type 1 von Willebrand disease patients.
22226963 2012 The impact of extracellular syntaxin4 on HaCaT keratinocyte behavior.
22045676 2011 Epimorphin promotes human hepatocellular carcinoma invasion and metastasis through activation of focal adhesion kinase/extracellular signal-regulated kinase/matrix metalloproteinase-9 axis.
21810271 2011 Combined analysis of three genome-wide association studies on vWF and FVIII plasma levels.
21720706 2011 Syntaxins 3 and 4 mediate vesicular trafficking of ?5?1 and ?3?1 integrins and cancer cell migration.
21156930 2010 Effect of genetic variations in syntaxin-binding protein-5 and syntaxin-2 on von Willebrand factor concentration and cardiovascular risk.
More...