Property Summary

NCBI Gene PubMed Count 7
PubMed Score 10.31
PubTator Score 5.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.646 0.000
juvenile dermatomyositis 1.116 0.000
primary Sjogren syndrome 1.100 0.000
invasive ductal carcinoma -1.600 0.010
Breast cancer 1.200 0.000

Gene RIF (2)

PMID Text
21531217 HLTF methylation may exist in gastric cardia dysplasia stages and may play important role in the development of gastric cardia adenocarcinoma.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGPVIGMTPDKRAETPGAEKIAGLSQIYKMGSLPEAVDAARPKATLVDSESADDELTNLNWLHESTNLLT      1 - 70
NFSLGSEGLPIVSPLYDIEGDDVPSFGPACYQNPEKKSATSKPPYSFSLLIYMAIEHSPNKCLPVKEIYS     71 - 140
WILDHFPYFATAPTGWKNSVRHNLSLNKCFQKVERSHGKVNGKGSLWCVDPEYKPNLIQALKKQPFSSAS    141 - 210
SQNGSLSPHYLSSVIKQNQVRNLKESDIDAAAAMMLLNTSIEQGILECEKPLPLKTALQKKRSYGNAFHH    211 - 280
PSAVRLQESDSLATSIDPKEDHNYSASSMAAQRCASRSSVSSLSSVDEVYEFIPKNSHVGSDGSEGFHSE    281 - 350
EDTDVDYEDDPLGDSGYASQPCAKISEKGQSGKKMRKQTCQEIDEELKEAAGSLLHLAGIRTCLGSLIST    351 - 420
AKTQNQKQRKK                                                               421 - 431
//

Text Mined References (9)

PMID Year Title
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
21531217 2011 Aberrant methylation of the CpG island of HLTF gene in gastric cardia adenocarcinoma and dysplasia.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
1639393 1992 Characterization and chromosomal mapping of the gene encoding the cellular DNA binding protein HTLF.