Property Summary

NCBI Gene PubMed Count 75
Grant Count 86
R01 Count 52
Funding $5,674,962.02
PubMed Score 297.61
PubTator Score 130.88

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P32243 B2RAN5 Q6GTV3 Q9HAW3 Q9P2R1
Symbols CPHD6
MCOPS5

Gene

Gene RIF (58)

PMID Text
26554466 demonstrated the role of OTX2 on TAp63 regulation necessary for the correct formation of macular neuroepithelium
26398939 A novel role for OTX2 in self-renewal and migration of human embryonic neural precursors and Medulloblastoma cells, is reported.
26397460 Loss of OTX2 expression resulted in decreased expression of C-MYC and CRX, genes previously implicated in retinoblastoma tumorigenesis. Loss of OTX2 expression increased the phosphorylation of RB, a potential mechanism of modulating cell proliferation
25589041 Agnathia-otocephaly complex and asymmetric velopharyngeal insufficiency due to an in-frame duplication in OTX2.
25571874 This epigenome-wide DNA methylation analysis in postmortem hippocampus and prefrontal cortex specimens confirmed OTX2 DNA methylation profiles in major depression
25542770 SOX2, OTX2 and PAX6 analysis in subjects with anophthalmia and microphthalmia
25351180 We showed that miR-410 directly regulates predicted target genes OTX2 and RPE65.
25293953 OTX2 mutations cause autosomal dominant pattern dystrophy of the retinal pigment epithelium.
25198066 OTX2 overexpression is associated with medulloblastoma.
24816892 a role for OTX2 dosage sensitivity in human craniofacial development
More...

AA Sequence

MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREE      1 - 70
VALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVP     71 - 140
TIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHH    141 - 210
QLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQ    211 - 280
TSSWKFQVL                                                                 281 - 289
//

Text Mined References (76)

PMID Year Title
26554466 2015 OTX2 regulates the expression of TAp63 leading to macular and cochlear neuroepithelium development.
26398939 2015 OTX2 exhibits cell-context-dependent effects on cellular and molecular properties of human embryonic neural precursors and medulloblastoma cells.
26397460 2015 OTX2 is a therapeutic target for retinoblastoma and may function as a common factor between C-MYC, CRX, and phosphorylated RB pathways.
25589041 2015 Agnathia-otocephaly complex and asymmetric velopharyngeal insufficiency due to an in-frame duplication in OTX2.
25571874 2015 Aberrant NMDA receptor DNA methylation detected by epigenome-wide analysis of hippocampus and prefrontal cortex in major depression.
25542770 2015 SOX2, OTX2 and PAX6 analysis in subjects with anophthalmia and microphthalmia.
25351180 2015 miR-410 Inhibition Induces RPE Differentiation of Amniotic Epithelial Stem Cells via Overexpression of OTX2 and RPE65.
25293953 2014 OTX2 mutations cause autosomal dominant pattern dystrophy of the retinal pigment epithelium.
25198066 2014 Chromatin accessibility mapping identifies mediators of basal transcription and retinoid-induced repression of OTX2 in medulloblastoma.
24816892 2014 OTX2 duplication is implicated in hemifacial microsomia.
More...