Property Summary

NCBI Gene PubMed Count 35
PubMed Score 67.84
PubTator Score 27.69

Knowledge Summary

Patent

No data available

Expression

Gene RIF (12)

AA Sequence

MMSYLKQPPYGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREE      1 - 70
VALKINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSPVRESSGSESSGQFTPPAVSSSASSSS     71 - 140
SASSSSANPAAAAAAGLGGNPVAAASSLSTPAASSIWSPASISPGSAPASVSVPEPLAAPSNTSCMQRSV    141 - 210
AAGAATAAASYPMSYGQGGSYGQGYPTPSSSYFGGVDCSSYLAPMHSHHHPHQLSPMAPSSMAGHHHHHP    211 - 280
HAHHPLSQSSGHHHHHHHHHHQGYGGSGLAFNSADCLDYKEPGAAAASSAWKLNFNSPDCLDYKDQASWR    281 - 350
FQVL                                                                      351 - 354
//

Text Mined References (37)

PMID Year Title