Property Summary

NCBI Gene PubMed Count 32
Grant Count 15
R01 Count 9
Funding $1,395,111.99
PubMed Score 64.96
PubTator Score 27.69

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
25203062 Genitalia defects in these patients could result from the effect of OTX1.
24388989 overexpression of OTX1 results in accumulation of colorectal cancer (CRC) cell proliferation and invasion in vitro and tumor growth in vivo, whereas ablation of OTX1 expression inhibits the proliferative and invasive capability of CRC cell lines
21750575 XPO1 and OXT1 may contribute to ASD in 2p15-p16.1 deletion cases and non-deletion cases of ASD mapping to this chromosome region.
21478910 established that the p53 protein directly induces OTX1 expression by acting on its promoter
20354145 The early expression of OTX1 in proliferative cell layers of the human fetal brain supports the concept that this homeobox gene is important in neuronal cell development and differentiation.
19893048 This study identifies OTX1 as a molecular marker for high-grade germinal center derived Non-Hodgkin Lymphoma
19414065 In the human fetal eye, OTX1 expression was confined to anterior retina.
19018235 Observational study of gene-disease association. (HuGE Navigator)
18849347 OTR1, OTX2 and CRX act as positive modulators of the BEST1 promoter in the retinal pigment epithelium.
11901358 Fine mapping of the chromosome 2p12-16 dyslexia susceptibility locus candidate gene

AA Sequence

MMSYLKQPPYGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREE      1 - 70
VALKINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSPVRESSGSESSGQFTPPAVSSSASSSS     71 - 140
SASSSSANPAAAAAAGLGGNPVAAASSLSTPAASSIWSPASISPGSAPASVSVPEPLAAPSNTSCMQRSV    141 - 210
AAGAATAAASYPMSYGQGGSYGQGYPTPSSSYFGGVDCSSYLAPMHSHHHPHQLSPMAPSSMAGHHHHHP    211 - 280
HAHHPLSQSSGHHHHHHHHHHQGYGGSGLAFNSADCLDYKEPGAAAASSAWKLNFNSPDCLDYKDQASWR    281 - 350
FQVL                                                                      351 - 354
//

Text Mined References (33)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25416956 2014 A proteome-scale map of the human interactome network.
25203062 2014 Genitourinary defects associated with genomic deletions in 2p15 encompassing OTX1.
24388989 2014 OTX1 promotes colorectal cancer progression through epithelial-mesenchymal transition.
24098394 2013 Transcriptome comparison of human neurons generated using induced pluripotent stem cells derived from dental pulp and skin fibroblasts.
23649504 2013 Novel gene expression model for outcome prediction in paediatric medulloblastoma.
23369722 2013 Hypermethylation of the polycomb group target gene PCDH7 in bladder tumors from patients of all ages.
23051705 2013 HOX gene methylation status analysis in patients with hereditary breast cancer.
21750575 2011 2p15-p16.1 microdeletion syndrome: molecular characterization and association of the OTX1 and XPO1 genes with autism spectrum disorders.
More...