Property Summary

NCBI Gene PubMed Count 24
Grant Count 121
R01 Count 61
Funding $17,922,122.59
PubMed Score 595.17
PubTator Score 35.96

Knowledge Summary

Patent

No data available

Synonym

Accession P31995 O00523 O00524 O00525 IgG Fc receptor II-c
Symbols CD32
FCG2
CD32C
CDW32
IGFR2
FCRIIC

Gene

PANTHER Protein Class (1)

PDB

3WJL  

Gene RIF (15)

PMID Text
27015273 FCGR2C SNPs that associated with vaccine efficacy in RV144 also strongly associated with the expression of FCGR2A/C and one of them also associated with the expression of Fc receptor-like A (FCRLA), another Fc-gamma receptor (FcgammaR) gene
26133275 These include an FCGR2A/2C chimeric gene that causes a decreased expression
26116899 HIV-1 Vpr upregulates the gene expression of FCGR2C in human monocyte-derived dendritic cells
26032265 Data show that gains or losses in copy numbers of Fc gamma receptors FCGR3A were less frequent than for FCGR3B and FCGR2C.
25105367 sequenced exons and surrounding areas of FcR-encoding genes and found one FCGR2C tag SNP (rs114945036) that associated with vaccine efficacy against HIV-1 subtype CRF01_AE, with lysine at position 169 (169K) in the V2 loop (CRF01_AE 169K)
24353158 We report the discovery of allele-dependent expression of the activating FcgammaRIIc on B cells. Identical to FcgammaRIIb in the extracellular domain, FcgammaRIIc has a tyrosine-based activation motif in its cytoplasmic domain.
23778324 study concludes gene copy number of FcgammaR2C and FcgammaR3B influences IVIG treatment response and predisposes individuals to Kawasaki disease, providing potential insights into understanding the mechanism of the FcgammaR gene family in the IVIG pathway
23261299 Genomic pathology of SLE-associated copy-number variation at the FCGR2C/FCGR3B/FCGR2B locus.(28-40) Status: Complete Incomplete Delete
22198951 Two additional variations in FcgammaRIIb/c expression on leukocytes have now been identified; findings demonstrate a more extensive and previously unnoticed variation in FcgammaR expression with relevance to immunity and inflammation.
20978933 Fragment c gamma receptor gene polymorphisms is not associated with breast cancer.
More...

AA Sequence

MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWINVLQEDSVTLT      1 - 70
CRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHL     71 - 140
EFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPV    141 - 210
TITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQP    211 - 280
EETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN                               281 - 323
//

Publication (26)

PMID Year Title
27015273 2016 FCGR2C Polymorphisms Associated with HIV-1 Vaccine Protection Are Linked to Altered Gene Expression of Fc-? Receptors in Human B Cells.
26133275 2015 Nonallelic homologous recombination of the FCGR2/3 locus results in copy number variation and novel chimeric FCGR2 genes with aberrant functional expression.
26032265 2015 Allelic and copy-number variations of Fc?Rs affect granulocyte function and susceptibility for autoimmune blistering diseases.
25105367 2014 FCGR2C polymorphisms associate with HIV-1 vaccine protection in RV144 trial.
24353158 2013 Allelic-dependent expression of an activating Fc receptor on B cells enhances humoral immune responses.
23778324 2013 Fc?R gene copy number in Kawasaki disease and intravenous immunoglobulin treatment response.
23744091 2013 Engineered antibody Fc variant with selectively enhanced Fc?RIIb binding over both Fc?RIIa(R131) and Fc?RIIa(H131).
23261299 2013 Genomic pathology of SLE-associated copy-number variation at the FCGR2C/FCGR3B/FCGR2B locus.
22198951 2012 Phenotypic variation in IgG receptors by nonclassical FCGR2C alleles.
20978933 2011 Comments on: Iwasaki et al. Fragment c gamma receptor gene polymorphisms and breast cancer risk in case-control studies in Japanese, Japanese Brazilians, and non-Japanese Brazilians.
More...