Property Summary

NCBI Gene PubMed Count 28
PubMed Score 619.43
PubTator Score 35.96

Knowledge Summary

Patent

No data available

 GO Process (1)

Gene RIF (19)

AA Sequence

MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWINVLQEDSVTLT      1 - 70
CRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHL     71 - 140
EFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPV    141 - 210
TITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQP    211 - 280
EETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN                               281 - 323
//

Text Mined References (30)

PMID Year Title