Property Summary

NCBI Gene PubMed Count 66
PubMed Score 683.81
PubTator Score 258.44

Knowledge Summary


No data available


  Disease Sources (4)

Disease Target Count P-value
juvenile dermatomyositis 1189 3.61264297014386E-10
atypical teratoid / rhabdoid tumor 4369 1.3591425176863E-7
ovarian cancer 8492 2.38796137809608E-7
osteosarcoma 7933 3.01889837550524E-7
group 4 medulloblastoma 1875 8.51495402526806E-7
Pick disease 1893 1.90746841363181E-6
pediatric high grade glioma 2712 7.82595026734368E-6
medulloblastoma, large-cell 6234 9.84139057500583E-6
lung cancer 4473 2.63623819294427E-5
Amyotrophic Lateral Sclerosis 432 2.67571312133725E-5
primitive neuroectodermal tumor 3031 3.56083506689783E-5
glioblastoma 5572 7.62933250480553E-5
lung adenocarcinoma 2714 1.40653174241123E-4
dermatomyositis 967 3.41348129378957E-4
nasopharyngeal carcinoma 1056 0.00162509602654638
Waldenstrons macroglobulinemia 765 0.00193913584799243
Gaucher disease type 3 76 0.00355025900581983
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0037439278891677
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00674850244614828
astrocytic glioma 2241 0.00893658006665735
progressive supranuclear palsy 674 0.0100894592284168
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0124109790128
ependymoma 2514 0.0180539814859311
oligodendroglioma 2849 0.0271003753944137
aldosterone-producing adenoma 664 0.0349331790525477
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0471669449277511
invasive ductal carcinoma 2950 0.0493100556529352
Disease Target Count
Distal myopathy, Welander type 1



Accession P31483 Q53SS9 Q96B58
Symbols WDM



2MJN   3BS9  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG
S.cerevisiae OMA EggNOG

Gene RIF (48)

26738979 This study showed that reactive oxygen species such as H2O2 oxidize the cytoplasmic stress granules (SG)-nucleating protein TIA1, thereby inhibiting SG assembly.
26681690 AT1R mRNA is regulated by TIA-1 in a ER stress-dependent manner.
26363455 results suggest that TIA-1 and TIAR are two new host factors that interact with 5-UTR of EV71 genome and positively regulate viral replication
25673011 SERPINE1 mRNA dissociates from the translational repressor proteins Ago2 and TIA-1 upon platelet activation
25405991 TIA proteins play a role in the regulation and/or modulation of cellular homeostasis related to focal/cell adhesion, extracellular matrix and membrane and cytoskeleton dynamics.
25224594 Alternative splicing of TIA-1 in human colon cancer regulates VEGF isoform expression, angiogenesis, tumour growth and bevacizumab resistance.
24927121 TIA1-knockdown HeLa cells show an increase in ribosomes and translational machinery components.
24766723 TIA proteins can function as long-term regulators of the ACTB mRNA metabolism in mouse and human cells.
24682828 Structural insights into the role of binding avidity and the contributions of the TIA-1 RNA recognition motifs for recognition of pyrimidine-rich RNAs.
24566137 TIA1 inhibition of the exon 8 exclusion led to a decrease in SIRT1-Exon8 mRNA levels.

AA Sequence

APWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ                                      351 - 386

Text Mined References (71)

PMID Year Title
26738979 2016 TIA1 oxidation inhibits stress granule assembly and sensitizes cells to stress-induced apoptosis.
26681690 2016 Endoplasmic reticulum stress increases AT1R mRNA expression via TIA-1-dependent mechanism.
26363455 2015 TIA-1 and TIAR interact with 5'-UTR of enterovirus 71 genome and facilitate viral replication.
25673011 2015 Dissociation of SERPINE1 mRNA from the translational repressor proteins Ago2 and TIA-1 upon platelet activation.
25405991 2014 Long-term reduction of T-cell intracellular antigens reveals a transcriptome associated with extracellular matrix and cell adhesion components.
25224594 2015 Alternative splicing of TIA-1 in human colon cancer regulates VEGF isoform expression, angiogenesis, tumour growth and bevacizumab resistance.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24927121 2014 Genome-wide profiling reveals a role for T-cell intracellular antigens TIA1 and TIAR in the control of translational specificity in HeLa cells.
24766723 2014 Long-term reduction of T-cell intracellular antigens leads to increased beta-actin expression.