Property Summary

NCBI Gene PubMed Count 66
Grant Count 52
R01 Count 29
Funding $3,915,640.72
PubMed Score 683.81
PubTator Score 258.44

Knowledge Summary

Patent

No data available

Expression

Gene RIF (48)

PMID Text
26738979 This study showed that reactive oxygen species such as H2O2 oxidize the cytoplasmic stress granules (SG)-nucleating protein TIA1, thereby inhibiting SG assembly.
26681690 AT1R mRNA is regulated by TIA-1 in a ER stress-dependent manner.
26363455 results suggest that TIA-1 and TIAR are two new host factors that interact with 5-UTR of EV71 genome and positively regulate viral replication
25673011 SERPINE1 mRNA dissociates from the translational repressor proteins Ago2 and TIA-1 upon platelet activation
25405991 TIA proteins play a role in the regulation and/or modulation of cellular homeostasis related to focal/cell adhesion, extracellular matrix and membrane and cytoskeleton dynamics.
25224594 Alternative splicing of TIA-1 in human colon cancer regulates VEGF isoform expression, angiogenesis, tumour growth and bevacizumab resistance.
24927121 TIA1-knockdown HeLa cells show an increase in ribosomes and translational machinery components.
24766723 TIA proteins can function as long-term regulators of the ACTB mRNA metabolism in mouse and human cells.
24682828 Structural insights into the role of binding avidity and the contributions of the TIA-1 RNA recognition motifs for recognition of pyrimidine-rich RNAs.
24566137 TIA1 inhibition of the exon 8 exclusion led to a decrease in SIRT1-Exon8 mRNA levels.
More...

AA Sequence

MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRK      1 - 70
IMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKD     71 - 140
MATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSS    141 - 210
PSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVK    211 - 280
CYWGKETLDMINPVQQQNQIGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSS    281 - 350
APWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ                                      351 - 386
//

Text Mined References (71)

PMID Year Title
26738979 2016 TIA1 oxidation inhibits stress granule assembly and sensitizes cells to stress-induced apoptosis.
26681690 2016 Endoplasmic reticulum stress increases AT1R mRNA expression via TIA-1-dependent mechanism.
26363455 2015 TIA-1 and TIAR interact with 5'-UTR of enterovirus 71 genome and facilitate viral replication.
25673011 2015 Dissociation of SERPINE1 mRNA from the translational repressor proteins Ago2 and TIA-1 upon platelet activation.
25405991 2014 Long-term reduction of T-cell intracellular antigens reveals a transcriptome associated with extracellular matrix and cell adhesion components.
25224594 2015 Alternative splicing of TIA-1 in human colon cancer regulates VEGF isoform expression, angiogenesis, tumour growth and bevacizumab resistance.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24927121 2014 Genome-wide profiling reveals a role for T-cell intracellular antigens TIA1 and TIAR in the control of translational specificity in HeLa cells.
24766723 2014 Long-term reduction of T-cell intracellular antigens leads to increased beta-actin expression.
More...