Property Summary

NCBI Gene PubMed Count 70
Grant Count 54
R01 Count 28
Funding $4,586,854.03
PubMed Score 179.89
PubTator Score 67.72

Knowledge Summary

Patent

No data available

Expression

Gene RIF (30)

PMID Text
26158466 Release of pRIIbeta in the presence of cAMP is reduced by calcium, whereas autophosphorylation at the phosphorylation site inhibits holoenzyme reassociation with the catalytic subunit.
25477193 Leu206Arg and Leu199_Cys200insTrp mutations in PRKACA impair its association with PRKAR2B and PRKAR1A.
25268545 Although the depletion of PRKAR1A and PRKAR2B in adrenocortical cells has similar effects on cell proliferation and apoptosis; loss of these PKA subunits differentially affects cyclin expression.
24737441 Because of limited power, PRKAR2B's role in antipsychotic-induced weight gain is unclear, but biological evidence suggests that PRKAR2B may be involved
24189052 Protein kinase A (PKA) binds and phosphorylates A3G at Thr32 in vitro and in vivo. This phosphorylation event reduces the binding of A3G to Vif and its subsequent ubiquitination and degradation
21651489 Protein kinase A (PKA) binds and phosphorylates A3G at Thr32 in vitro and in vivo. This phosphorylation event reduces the binding of A3G to Vif and its subsequent ubiquitination and degradation
21068099 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20402410 Protein kinase A (PKA) binds and phosphorylates A3G at Thr32 in vitro and in vivo. This phosphorylation event reduces the binding of A3G to Vif and its subsequent ubiquitination and degradation
20392842 Protein kinase A (PKA) binds and phosphorylates A3G at Thr32 in vitro and in vivo. This phosphorylation event reduces the binding of A3G to Vif and its subsequent ubiquitination and degradation
20379146 Observational study and genome-wide association study of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFGHEGRTWGDLGAAAGGGTP      1 - 70
SKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAYNPDEEEDDAESRIIHPKTDD     71 - 140
QRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKDGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGR    141 - 210
CVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSL    211 - 280
EFSERLKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYF    281 - 350
GELALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA      351 - 418
//

Text Mined References (77)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26158466 2015 Single Turnover Autophosphorylation Cycle of the PKA RII? Holoenzyme.
25477193 2014 PKA catalytic subunit mutations in adrenocortical Cushing's adenoma impair association with the regulatory subunit.
25268545 2014 Comparison of the effects of PRKAR1A and PRKAR2B depletion on signaling pathways, cell growth, and cell cycle control of adrenocortical cells.
24737441 2014 Protein kinase cAMP-dependent regulatory type II beta (PRKAR2B) gene variants in antipsychotic-induced weight gain.
24662972 2014 Genome-wide interaction study of smoking and bladder cancer risk.
24605759 2014 Cyclic nucleotide mapping of hyperpolarization-activated cyclic nucleotide-gated (HCN) channels.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
More...