Property Summary

NCBI Gene PubMed Count 74
PubMed Score 183.26
PubTator Score 67.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Heart failure 157 0.0 0.0
Obesity 655 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.7
Disease Target Count Z-score Confidence
Dermatitis 154 0.0 0.9

Expression

  Differential Expression (33)

Disease log2 FC p
active Crohn's disease 1.671 1.8e-02
acute quadriplegic myopathy 1.110 9.9e-06
adult high grade glioma -1.400 3.2e-02
astrocytic glioma -2.300 4.3e-03
Astrocytoma, Pilocytic -1.600 6.1e-04
atypical teratoid / rhabdoid tumor -2.100 4.8e-04
autosomal dominant Emery-Dreifuss muscul... 2.170 3.3e-03
colon cancer -1.800 5.0e-07
cystic fibrosis 1.825 2.5e-06
Duchenne muscular dystrophy 1.073 4.0e-03
ductal carcinoma in situ -2.700 5.4e-04
ependymoma -2.700 3.6e-03
gastric cancer 1.200 8.3e-03
glioblastoma -1.200 1.2e-03
intraductal papillary-mucinous adenoma (... -3.600 2.9e-05
intraductal papillary-mucinous carcinoma... -3.800 2.5e-05
intraductal papillary-mucinous neoplasm ... -2.800 1.2e-02
invasive ductal carcinoma -1.178 7.5e-04
lung cancer -1.800 1.3e-04
malignant mesothelioma 1.500 2.2e-04
medulloblastoma, large-cell -2.800 1.6e-03
nasopharyngeal carcinoma 1.200 3.1e-02
non primary Sjogren syndrome sicca 1.300 1.6e-02
non-small cell lung cancer -1.107 3.1e-09
oligodendroglioma -1.500 2.3e-02
ovarian cancer -3.700 4.4e-09
pancreatic cancer 1.700 1.5e-03
pancreatic carcinoma 1.700 1.5e-03
psoriasis -1.300 1.1e-04
sarcoidosis 1.500 4.6e-03
severe Alzheimer's disease -1.345 3.4e-02
tuberculosis 1.100 1.2e-02
ulcerative colitis 1.600 6.5e-07

Gene RIF (30)

AA Sequence

MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFGHEGRTWGDLGAAAGGGTP      1 - 70
SKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAYNPDEEEDDAESRIIHPKTDD     71 - 140
QRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKDGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGR    141 - 210
CVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSL    211 - 280
EFSERLKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYF    281 - 350
GELALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA      351 - 418
//

Text Mined References (81)

PMID Year Title