Property Summary

NCBI Gene PubMed Count 15
PubMed Score 9.41
PubTator Score 8.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
cutaneous lupus erythematosus -1.500 7.0e-04
lung adenocarcinoma -1.200 1.1e-12
malignant mesothelioma -1.900 2.0e-06

Gene RIF (4)

AA Sequence

MSSYFVNPTFPGSLPSGQDSFLGQLPLYQAGYDALRPFPASYGASSLPDKTYTSPCFYQQSNSVLACNRA      1 - 70
SYEYGASCFYSDKDLSGASPSGSGKQRGPGDYLHFSPEQQYKPDSSSGQGKALHDEGADRKYTSPVYPWM     71 - 140
QRMNSCAGAVYGSHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKW    141 - 210
KKENKLINSTQPSGEDSEAKAGE                                                   211 - 233
//

Text Mined References (15)

PMID Year Title