Property Summary

NCBI Gene PubMed Count 15
Grant Count 10
Funding $1,679,451.17
PubMed Score 9.36
PubTator Score 8.51

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -1.900 0.000
cutaneous lupus erythematosus -1.500 0.001
lung adenocarcinoma -1.200 0.000

Gene RIF (4)

PMID Text
23539541 HOXA6 is a signature gene involved in cell growth and sensitivity to chemotherapy in acute myeloid leukemia cells.
23349797 Data indicate that genes with hypermethylated CpG islands in malignant meningiomas, such as HOXA6 and HOXA9, tend to coincide with the binding sites of polycomb repressive complexes (PRC) in early developmental stage.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19157684 Enforced overexpression of HOXA6 or HOXA9 in FDCP-Mix resulted in increased proliferation and colony formation but had negligible effect on differentiation in early multipotential and later committed precursor cells

AA Sequence

MSSYFVNPTFPGSLPSGQDSFLGQLPLYQAGYDALRPFPASYGASSLPDKTYTSPCFYQQSNSVLACNRA      1 - 70
SYEYGASCFYSDKDLSGASPSGSGKQRGPGDYLHFSPEQQYKPDSSSGQGKALHDEGADRKYTSPVYPWM     71 - 140
QRMNSCAGAVYGSHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKW    141 - 210
KKENKLINSTQPSGEDSEAKAGE                                                   211 - 233
//

Text Mined References (15)

PMID Year Title
23539541 2013 HOXA/PBX3 knockdown impairs growth and sensitizes cytogenetically normal acute myeloid leukemia cells to chemotherapy.
23349797 2013 DNA methylation in the malignant transformation of meningiomas.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19157684 2009 Hoxa6 potentiates short-term hemopoietic cell proliferation and extended self-renewal.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11857506 2002 Complete mutation analysis panel of the 39 human HOX genes.
More...