Property Summary

NCBI Gene PubMed Count 57
Grant Count 22
R01 Count 9
Funding $1,685,173.93
PubMed Score 34.48
PubTator Score 120.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma -1.300 0.003
lung carcinoma 1.200 0.000
ovarian cancer 1.400 0.000

Gene RIF (13)

PMID Text
25694352 Human oligodendrogliomas cells stably expressing mutant GDI1 showed altered cell proliferation.
25346144 Data confirm isolated adrenocorticotropin deficiency (IAD) as autoimmune disease; RABGDIA (human, human recombinant, or rat) exhibits characteristics of autoantigen in anterior pituitary; patients with IAD exhibit autoantibodies against RABGDIA.
23140504 The results of this study identified RabGDI as a component of the switching mechanism that is required for commissural axons to change their response from attraction to repulsion at the intermediate target
22002931 GDI1 mutations cause an unspecific phenotype characterized by cognitive deficits of variable degree in males, and to a lesser degree in female carriers.
21736009 The mutations in this gene are common and do not seem to influence the gene expression so as to cause a change in phenotype.
20381070 This protein has been found differentially expressed in the anterior cingulate cortex from patients with schizophrenia
19996123 A model by which mutant PrP induces overexpression of GDI, activating a cytotoxic feedback loop that leads to protein accumulation in the secretory pathway.
19570034 GDI-1 is preferentially involved in insulin-stimulated glucose transporter 4 (GLUT4) translocation through facilitating Rab10 recycling.
18487148 The results of case-control analysis indicated that, no association between the rs11549300 polymorphisms of GDI1 and children NSMR (P >0.05), but its polymorphisms may be related to intelligence levels of children in Qinba region (P =0.03).
18487148 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLEGPPESMGRGR      1 - 70
DWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRF     71 - 140
RKFLVFVANFDENDPKTFEGVDPQTTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLDQPCLETVNRIK    141 - 210
LYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVDDIIMENGKVVGVKSEGEVARCKQL    211 - 280
ICDPSYIPDRVRKAGQVIRIICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISYAHNVAAQGKYI    281 - 350
AIASTTVETTDPEKEVEPALELLEPIDQKFVAISDLYEPIDDGCESQVFCSCSYDATTHFETTCNDIKDI    351 - 420
YKRMAGTAFDFENMKRKQNDVFGEAEQ                                               421 - 447
//

Text Mined References (60)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25694352 2015 Tumor-specific mutations in low-frequency genes affect their functional properties.
25416956 2014 A proteome-scale map of the human interactome network.
25346144 2015 Identification of the novel autoantigen candidate Rab GDP dissociation inhibitor alpha in isolated adrenocorticotropin deficiency.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23815289 2013 Rab1a and Rab5a preferentially bind to binary lipid compositions with higher stored curvature elastic energy.
23140504 2012 RabGDI controls axonal midline crossing by regulating Robo1 surface expression.
22002931 2011 Novel GDI1 mutation in a large family with nonsyndromic X-linked intellectual disability.
21736009 Mutations in GDI1 and X-linked non-specific mental retardation.
More...