Property Summary

NCBI Gene PubMed Count 58
PubMed Score 38.06
PubTator Score 120.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma -1.300 3.1e-03
lung carcinoma 1.200 6.1e-34
ovarian cancer 1.400 7.9e-06

Gene RIF (13)

AA Sequence

MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLEGPPESMGRGR      1 - 70
DWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRF     71 - 140
RKFLVFVANFDENDPKTFEGVDPQTTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLDQPCLETVNRIK    141 - 210
LYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVDDIIMENGKVVGVKSEGEVARCKQL    211 - 280
ICDPSYIPDRVRKAGQVIRIICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISYAHNVAAQGKYI    281 - 350
AIASTTVETTDPEKEVEPALELLEPIDQKFVAISDLYEPIDDGCESQVFCSCSYDATTHFETTCNDIKDI    351 - 420
YKRMAGTAFDFENMKRKQNDVFGEAEQ                                               421 - 447
//

Text Mined References (61)

PMID Year Title