Property Summary

NCBI Gene PubMed Count 89
Grant Count 251
R01 Count 157
Funding $32,396,517.79
PubMed Score 493.86
PubTator Score 614.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma 1.065 0.005
psoriasis 1.200 0.001
glioblastoma 1.600 0.000
medulloblastoma 1.600 0.000
atypical teratoid / rhabdoid tumor 2.000 0.000
medulloblastoma, large-cell -1.800 0.000
primitive neuroectodermal tumor 2.000 0.000
adult high grade glioma 1.500 0.000
pilocytic astrocytoma 1.500 0.000
Pick disease -1.200 0.000
ovarian cancer -1.200 0.001
dermatomyositis 1.300 0.001

Synonym

Accession P30533 D3DVR9 Q2M310 Q53HQ3 Q53HS6 Alpha-2-MRAP
Symbols RAP
MRAP
A2RAP
HBP44
MYP23
A2MRAP
alpha-2-MRAP

Gene

PDB

2FCW   2FYL   1LRE   1NRE   1OP1   1OV2   2FTU   2P01   2P03  

Gene RIF (40)

PMID Text
26271838 The clinical and biometric features we describe in this report characterize LRPAP1-related high myopia and should raise suspicion for mutations in the gene.
25159528 The inhibition caused by reagents that prevented the activation of Rap was reversed by mobilizing intracellular calcium pharmacologically, whereas that caused by acrosome reaction inhibitors that impeded Rab3's binding to GTP was not.
24504617 The LRPAP1 I allelic variant may be considered a candidate gene for PD, predominantly in patients having the APOE epsilon4 allelic variant.
23894629 RAP inhibited light chain (LC)endocytosis by approximately 88% and ameliorated LC-induced cytokine responses and epithelial-to-mesenchymal transformation in human proximal tubular cells.
23830514 Mutations in LRPAP1 are associated with severe myopia in humans.
23754288 Data indicate that the region of complement-type repeats 2-5 in LDLR was identified as the binding site for FVIII and for alpha-2-macroglobulin receptor-associated protein (RAP).
21062971 Observational study of gene-disease association. (HuGE Navigator)
20637261 LRP1-C/T, A2M-Ile/Val and APOE-epsilon 2/epsilon 3/epsilon 4 polymorphisms are associated with AD.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20403997 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MAPRRVRSFLRGLPALLLLLLFLGPWPAASHGGKYSREKNQPKPSPKRESGEEFRMEKLNQLWEKAQRLH      1 - 70
LPPVRLAELHADLKIQERDELAWKKLKLDGLDEDGEKEARLIRNLNVILAKYGLDGKKDARQVTSNSLSG     71 - 140
TQEDGLDDPRLEKLWHKAKTSGKFSGEELDKLWREFLHHKEKVHEYNVLLETLSRTEEIHENVISPSDLS    141 - 210
DIKGSVLHSRHTELKEKLRSINQGLDRLRRVSHQGYSTEAEFEEPRVIDLWDLAQSANLTDKELEAFREE    211 - 280
LKHFEAKIEKHNHYQKQLEIAHEKLRHAESVGDGERVSRSREKHALLEGRTKELGYTVKKHLQDLSGRIS    281 - 350
RARHNEL                                                                   351 - 357
//

Text Mined References (94)

PMID Year Title
26271838 2016 Clinical Characterization of LRPAP1-Related Pediatric High Myopia.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25159528 2014 Epac, Rap and Rab3 act in concert to mobilize calcium from sperm's acrosome during exocytosis.
24504617 2014 APOE and LRPAP1 gene polymorphism and risk of Parkinson's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23969696 2013 Multiethnic meta-analysis of genome-wide association studies in >100 000 subjects identifies 23 fibrinogen-associated Loci but no strong evidence of a causal association between circulating fibrinogen and cardiovascular disease.
23894629 2013 Receptor-associated protein blocks internalization and cytotoxicity of myeloma light chain in cultured human proximal tubular cells.
23830514 2013 Mutations in LRPAP1 are associated with severe myopia in humans.
23754288 2013 Mapping the binding region on the low density lipoprotein receptor for blood coagulation factor VIII.
More...