Property Summary

NCBI Gene PubMed Count 97
PubMed Score 516.05
PubTator Score 614.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma 1.500 3.6e-04
Astrocytoma, Pilocytic 1.400 4.7e-06
atypical teratoid / rhabdoid tumor -1.100 3.1e-04
dermatomyositis 1.300 1.2e-03
glioblastoma 1.500 8.8e-09
group 3 medulloblastoma 1.300 3.3e-03
medulloblastoma, large-cell -1.800 4.0e-07
Multiple myeloma 1.065 5.1e-03
ovarian cancer -1.200 7.7e-04
Pick disease -1.200 3.0e-07
primitive neuroectodermal tumor -1.100 4.7e-03
psoriasis 1.200 5.7e-04

Protein-protein Interaction (9)

Gene RIF (41)

AA Sequence

MAPRRVRSFLRGLPALLLLLLFLGPWPAASHGGKYSREKNQPKPSPKRESGEEFRMEKLNQLWEKAQRLH      1 - 70
LPPVRLAELHADLKIQERDELAWKKLKLDGLDEDGEKEARLIRNLNVILAKYGLDGKKDARQVTSNSLSG     71 - 140
TQEDGLDDPRLEKLWHKAKTSGKFSGEELDKLWREFLHHKEKVHEYNVLLETLSRTEEIHENVISPSDLS    141 - 210
DIKGSVLHSRHTELKEKLRSINQGLDRLRRVSHQGYSTEAEFEEPRVIDLWDLAQSANLTDKELEAFREE    211 - 280
LKHFEAKIEKHNHYQKQLEIAHEKLRHAESVGDGERVSRSREKHALLEGRTKELGYTVKKHLQDLSGRIS    281 - 350
RARHNEL                                                                   351 - 357
//

Text Mined References (102)

PMID Year Title