Property Summary

NCBI Gene PubMed Count 9
PubMed Score 47.87
PubTator Score 68.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
acute myeloid leukemia 1.600 2.6e-02
acute quadriplegic myopathy 1.035 2.6e-06
adult high grade glioma 1.400 9.1e-03
astrocytic glioma 1.300 4.5e-02
atypical teratoid / rhabdoid tumor 1.200 7.6e-03
Breast cancer -1.800 1.4e-28
ependymoma 1.100 2.8e-02
gastric cancer -1.100 4.3e-04
intraductal papillary-mucinous adenoma (... 1.200 6.5e-03
intraductal papillary-mucinous carcinoma... 1.200 2.0e-02
intraductal papillary-mucinous neoplasm ... 1.400 4.1e-03
oligodendroglioma 1.500 9.4e-04
osteosarcoma 1.273 5.5e-06
ovarian cancer -1.200 8.2e-11
pancreatic cancer -1.200 2.4e-04
pancreatic carcinoma -1.200 2.4e-04
pancreatic ductal adenocarcinoma liver m... 1.529 4.1e-02
Pick disease 1.500 1.7e-05
pituitary cancer -1.300 2.6e-04
progressive supranuclear palsy 1.300 9.6e-03
psoriasis -1.500 1.2e-04
Rheumatoid arthritis 1.700 3.1e-02
sarcoidosis 1.100 6.7e-03
tuberculosis and treatment for 6 months 1.200 1.0e-05

Gene RIF (1)

AA Sequence

MGAQDRPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKN      1 - 70
FMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVF     71 - 140
GLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVLATKSIKDVFEKKRKKPTHSEGSDSSSNSSSSSES    141 - 210
SSESELEHERSRRRKHKRRPKVKRSKKRRKEASSSEEPRNKHAMNPKGHSERSDTNEKRSVDSSAKREKP    211 - 280
VVRPEEIPPVPENRFLLRRDMPVVTAEPEPKIPDVAPIVSDQKPSVSKSGRKIKGRGTIRYHTPPRSRSC    281 - 350
SESDDDDSSETPPHWKEEMQRLRAYRPPSGEKWSKGDKLSDPCSSRWDERSLSQRSRSWSYNGYYSDLST    351 - 420
ARHSGHHKKRRKEKKVKHKKKGKKQKHCRRHKQTKKRRILIPSDIESSKSSTRRMKSSCDRERSSRSSSL    421 - 490
SSHHSSKRDWSKSDKDVQSSLTHSSRDSYRSKSHSQSYSRGSSRSRTASKSSSHSRSRSKSRSSSKSGHR    491 - 560
KRASKSPRKTASQLSENKPVKTEPLRATMAQNENVVVQPVVAENIPVIPLSDSPPPSRWKPGQKPWKPSY    561 - 630
ERIQEMKAKTTHLLPIQSTYSLANIKETGSSSSYHKREKNSESDQSTYSKYSDRSSESSPRSRSRSSRSR    631 - 700
SYSRSYTRSRSLASSHSRSRSPSSRSHSRNKYSDHSQCSRSSSYTSISSDDGRRAKRRLRSSGKKNSVSH    701 - 770
KKHSSSSEKTLHSKYVKGRDRSSCVRKYSESRSSLDYSSDSEQSSVQATQSAQEKEKQGQMERTHNKQEK    771 - 840
NRGEEKSKSERECPHSKKRTLKENLSDHLRNGSKPKRKNYAGSKWDSESNSERDVTKNSKNDSHPSSDKE    841 - 910
EGEATSDSESEVSEIHIKVKPTTKSSTNTSLPDDNGAWKSSKQRTSTSDSEGSCSNSENNRGKPQKHKHG    911 - 980
SKENLKREHTKKVKEKLKGKKDKKHKAPKRKQAFHWQPPLEFGEEEEEEIDDKQVTQESKEKKVSENNET    981 - 1050
IKDNILKTEKSSEEDLSGKHDTVTVSSDLDQFTKDDSKLSISPTALNTEENVACLQNIQHVEESVPNGVE   1051 - 1120
DVLQTDDNMEICTPDRSSPAKVEETSPLGNARLDTPDINIVLKQDMATEHPQAEVVKQESSMSESKVLGE   1121 - 1190
VGKQDSSSASLASAGESTGKKEVAEKSQINLIDKKWKPLQGVGNLAAPNAATSSAVEVKVLTTVPEMKPQ   1191 - 1260
GLRIEIKSKNKVRPGSLFDEVRKTARLNRRPRNQESSSDEQTPSRDDDSQSRSPSRSRSKSETKSRHRTR   1261 - 1330
SVSYSHSRSRSRSSTSSYRSRSYSRSRSRGWYSRGRTRSRSSSYRSYKSHRTSSRSRSRSSSYDPHSRSR   1331 - 1400
SYTYDSYYSRSRSRSRSQRSDSYHRGRSYNRRSRSCRSYGSDSESDRSYSHHRSPSESSRYS           1401 - 1462
//

Text Mined References (20)

PMID Year Title