Property Summary

NCBI Gene PubMed Count 81
PubMed Score 251.62
PubTator Score 237.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.100 5.4e-03
psoriasis 1.500 1.9e-10

Gene RIF (33)

AA Sequence

MWELRSASFWRAIFAEFFATLFYVFFGLGSSLRWAPGPLHVLQVAMAFGLALATLVQSVGHISGAHVNPA      1 - 70
VTFAFLVGSQMSLLRAFCYMAAQLLGAVAGAAVLYSVTPPAVRGNLALNTLHPAVSVGQATTVEIFLTLQ     71 - 140
FVLCIFATYDERRNGQLGSVALAVGFSLALGHLFGMYYTGAGMNPARSFAPAILTGNFTNHWVYWVGPII    141 - 210
GGGLGSLLYDFLLFPRLKSISERLSVLKGAKPDVSNGQPEVTGEPVELNTQAL                     211 - 263
//

Text Mined References (82)

PMID Year Title