Property Summary

NCBI Gene PubMed Count 19
PubMed Score 9.39
PubTator Score 9.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
nephrosclerosis -1.701 0.006
pancreatic cancer -1.600 0.002
malignant mesothelioma -1.900 0.000
osteosarcoma -1.004 0.012
adrenocortical carcinoma -1.052 0.002
primary pancreatic ductal adenocarcinoma -1.737 0.001
colon cancer -1.700 0.049
pancreatic carcinoma 1.100 0.003
subependymal giant cell astrocytoma 1.965 0.006
progressive supranuclear palsy -1.100 0.035
gastric carcinoma -2.300 0.042
ulcerative colitis -2.700 0.000
pituitary cancer 1.600 0.000

Gene RIF (4)

PMID Text
26594798 Data show that phenazine biosynthesis-like domain-containing protein (PBLD) is aberrantly downregulated in hepatocellular carcinoma (HCC).
26373288 MAWD and MAWBP were downregulated and associated with the differentiation grade in GC tissues.
23687415 Coexpression of MAWBP and MAWD inhibited epithelial mesenchymal transformation, and EMT-aided malignant cell progression was suppressed in gastric cancer.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLSETAFIRKLHPTDNFAQSSCFGLRWF      1 - 70
TPASEVPLCGHATLASAAVLFHKIKNMNSTLTFVTLSGELRARRAEDGIVLDLPLYPAHPQDFHEVEDLI     71 - 140
KTAIGNTLVQDICYSPDTQKLLVRLSDVYNRSFLENLKVNTENLLQVENTGKVKGLILTLKGEPGGQTQA    141 - 210
FDFYSRYFAPWVGVAEDPVTGSAHAVLSSYWSQHLGKKEMHAFQCSHRGGELGISLRPDGRVDIRGGAAV    211 - 280
VLEGTLTA                                                                  281 - 288
//

Text Mined References (23)

PMID Year Title
26594798 2016 Decreased expression of PBLD correlates with poor prognosis and functions as a tumor suppressor in human hepatocellular carcinoma.
26373288 2015 Mitogen-activated protein kinase activator with WD40 repeats (MAWD) and MAWD-binding protein induce cell differentiation in gastric cancer.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23687415 2013 MAWBP and MAWD inhibit proliferation and invasion in gastric cancer.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22068589 2012 Next generation sequencing identifies mutations in Atonal homolog 7 (ATOH7) in families with global eye developmental defects.
20548946 2010 A genome-wide association study of optic disc parameters.
More...