Property Summary

NCBI Gene PubMed Count 42
PubMed Score 94.56
PubTator Score 161.58

Knowledge Summary

Patent (3,032)

Expression

  Differential Expression (5)

Disease log2 FC p
cutaneous lupus erythematosus 1.600 1.7e-04
tuberculosis and treatment for 3 months -1.300 1.3e-04
interstitial cystitis 1.200 4.9e-05
lung adenocarcinoma 2.700 2.6e-09
inflammatory breast cancer 1.500 3.2e-03

Gene RIF (29)

PMID Text
25816245 data demonstrate that HNP-1 induces IL-8 production not only through P2Y6, but also through additional P2 receptors via an ERK1/2-dependent mechanism in intestinal epithelial cells.
25445541 high millimolar concentrations of ATP increased IL-8 and MCP-1 release by the glioma cells stimulated with suboptimal LPS concentration which were blocked by P2X7 and P2Y6 antagonists
25243587 nucleotides released during the airway inflammatory processes will activate P2Y6 receptors, which will lead to further release of inflammatory cytokines.
23723068 Data indicate that after P2Y6 receptor stimulation both phospholipase D (PLD) and DGKzeta enzymes are responsible for producing phosphatidic acid (PA).
22558990 no obvious correlation was found between the expression of P2Y6 and breast cancer cell proliferation
22249129 Results indicate involvement of P2Y purinoceptors P2Y(1) and P2Y(6) receptors in ADP- and UDP-stimulated proliferation.
22102722 P2Y(6) receptor signaling pathway may be a potential therapeutic target for MSU-associated inflammatory diseases, such as tophaceous gout.
21898410 Report role of ecto-NTPDases on UDP-sensitive P2Y(6) receptor activation during osteogenic differentiation of primary bone marrow stromal cells from postmenopausal women.
21724990 P2Y6 receptor transgene is an important endogenous inhibitor of T cell function in mice with allergic pulmonary inflammation
21388279 activation of P2Y6 receptor mediates the UVB-radiation-induced activation of p38 MAPK and expression of COX-2
21268712 P2Y6 receptors and ADAM17 mediates the low-dose gamma-radiation-induced activation of EGFR.
21173118 human microvascular endothelia exposed to inflammatory stimuli, followed by measurements of P2Y or P2X transcriptional responses, showed a selective induction of the P2Y(6) receptor
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19735076 Extracellular nucleotides, via P2Y2 and P2Y6 receptors, regulate neutrophil migration by controlling TLR2-induced IL-8 release from human monocytes.
19124756 Human mast cells express uridine diphosphate-selective P2Y6 receptors that cooperate with type 1 cysteinyl-leukotriene receptors to promote cell survival and chemokine generation by a pathway involving reciprocal ligand-mediated cross-talk.
19011163 P2Y agonists stimulate Ca(2+)-dependent Cl(-) secretion across human bronchial epithelia and that the cAMP/PKA pathway regulates apical but not basolateral P2Y(6) receptor-coupled ion transport in human bronchial epithelia
19008857 These results indicate that activation of Galpha(12/13) in cardiomyocytes by the extracellular nucleotides-stimulated P2Y(6) receptor triggers fibrosis in pressure overload-induced cardiac fibrosis
18250478 P2Y6 receptor expression is increased by the stress-associated inflammatory response of Caco-2 intestinal epithelial cells.
17971163 modulation of human cavernosal smooth muscle relaxation can be achieved by activation of the P2Y6 receptor via non-neuronal and non-NO-dependent mechanisms, reinforcing the possible involvement of purinergic signalling in the erectile process
17762175 on/off effect of IL-13 on P2Y(6)-induced Cl-secretion may help to identify the molecular determinants responsible for the CaCC channel activity
16543499 inotropic effects of UDP, mediated by P2Y6 receptors
16322472 P2Y receptors revealed that the P2Y6 (ligand of UDP) signaling pathway plays a predominant role in mediating human neutrophil peptides-induced IL-8 production.
15796906 findings expand the pro-inflammatory biology of UDP mediated by the P2Y6 receptor
12716436 P2Y6 receptors highly responsive to UDP are endogenously expressed in human neuroblastoma SK-N-BE(2)C cells and they are involved in modulation of phospholipase C-coupled receptor-mediated Ca2+ mobilization by depleting the IP3-sensitive Ca2+ stores
12691958 Adenine and uracil nucleotides differentially activate this receptor, which regulates the proliferation of lung cancer cells
12623123 P2Y(6) receptors interact rapidly with the TNF alpha-related intracellular signals to prevent apoptotic cell death.
12464620 hypertonic stress increases T cell interleukin-2 expression through a mechanism that involves ATP release, P2 receptor, and p38 MAPK activation
11690642 expression profile in human peripheral tissues and brain regions using PCR
8700127 Using rat P2Y6 recombinant protein expressed in human astrocytoma cells, the authors found that the P2Y6 receptor is highly selective for UDP over UTP.

AA Sequence

MEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQICTSRRALTRTAVYTLNLAL      1 - 70
ADLLYACSLPLLIYNYAQGDHWPFGDFACRLVRFLFYANLHGSILFLTCISFQRYLGICHPLAPWHKRGG     71 - 140
RRAAWLVCVAVWLAVTTQCLPTAIFAATGIQRNRTVCYDLSPPALATHYMPYGMALTVIGFLLPFAALLA    141 - 210
CYCLLACRLCRQDGPAEPVAQERRGKAARMAVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFA    211 - 280
AAYKGTRPFASANSVLDPILFYFTQKKFRRRPHELLQKLTAKWQRQGR                          281 - 328
//

Text Mined References (42)

PMID Year Title
25816245 2015 Human neutrophil peptides induce interleukin-8 in intestinal epithelial cells through the P2 receptor and ERK1/2 signaling pathways.
25445541 2015 Nucleotide receptors control IL-8/CXCL8 and MCP-1/CCL2 secretions as well as proliferation in human glioma cells.
25416956 2014 A proteome-scale map of the human interactome network.
25243587 2014 P2Y6 receptor-mediated proinflammatory signaling in human bronchial epithelia.
23723068 2013 Regulation of phospholipase D activity and phosphatidic acid production after purinergic (P2Y6) receptor stimulation.
22558990 2012 [Construction of P2Y6 constitutive knock down breast cancer cell line and evaluation of its proliferation].
22249129 2012 P2Y receptors regulate proliferation of human pancreatic duct epithelial cells.
22102722 2012 P2Y6 receptor signaling pathway mediates inflammatory responses induced by monosodium urate crystals.
21898410 2012 Role of ecto-NTPDases on UDP-sensitive P2Y(6) receptor activation during osteogenic differentiation of primary bone marrow stromal cells from postmenopausal women.
21724990 2011 The purinergic G protein-coupled receptor 6 inhibits effector T cell activation in allergic pulmonary inflammation.
21388279 2011 Involvement of P2Y6 receptor in p38 MAPK-mediated COX-2 expression in response to UVB irradiation of human keratinocytes.
21268712 2011 P2Y6 receptors and ADAM17 mediate low-dose gamma-ray-induced focus formation (activation) of EGF receptor.
21173118 2011 Selective induction of endothelial P2Y6 nucleotide receptor promotes vascular inflammation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19735076 2009 Concomitant activation of P2Y(2) and P2Y(6) receptors on monocytes is required for TLR1/2-induced neutrophil migration by regulating IL-8 secretion.
19124756 2009 P2Y6 receptors require an intact cysteinyl leukotriene synthetic and signaling system to induce survival and activation of mast cells.
19011163 2009 Apical versus basolateral P2Y(6) receptor-mediated Cl(-) secretion in immortalized bronchial epithelia.
19008857 2008 P2Y6 receptor-Galpha12/13 signalling in cardiomyocytes triggers pressure overload-induced cardiac fibrosis.
18250478 2008 Intestinal inflammation increases the expression of the P2Y6 receptor on epithelial cells and the release of CXC chemokine ligand 8 by UDP.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17971163 2009 Purinergic modulation of human corpus cavernosum relaxation.
17762175 2007 Enhancement of P2Y6-induced Cl- secretion by IL-13 and modulation of SK4 channels activity in human bronchial cells.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16543499 2006 Positive inotropic effects by uridine triphosphate (UTP) and uridine diphosphate (UDP) via P2Y2 and P2Y6 receptors on cardiomyocytes and release of UTP in man during myocardial infarction.
16322472 2006 Human neutrophil peptides induce interleukin-8 production through the P2Y6 signaling pathway.
15796906 2005 The pyrimidinergic P2Y6 receptor mediates a novel release of proinflammatory cytokines and chemokines in monocytic cells stimulated with UDP.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12716436 2003 Attenuation of signal flow from P2Y6 receptor by protein kinase C-alpha in SK-N-BE(2)C human neuroblastoma cells.
12691958 2003 ATP- and UTP-activated P2Y receptors differently regulate proliferation of human lung epithelial tumor cells.
12623123 2003 Tumor necrosis factor alpha-induced apoptosis in astrocytes is prevented by the activation of P2Y6, but not P2Y4 nucleotide receptors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12464620 2003 Hypertonic stress increases T cell interleukin-2 expression through a mechanism that involves ATP release, P2 receptor, and p38 MAPK activation.
11788430 2002 UDP acts as a growth factor for vascular smooth muscle cells by activation of P2Y(6) receptors.
11690642 2001 Expression pattern of human P2Y receptor subtypes: a quantitative reverse transcription-polymerase chain reaction study.
11114308 2001 Differential regulation of the uridine nucleotide-activated P2Y4 and P2Y6 receptors. SER-333 and SER-334 in the carboxyl terminus are involved in agonist-dependent phosphorylation desensitization and internalization of the P2Y4 receptor.
9542531 1997 Colocalization of P2Y2 and P2Y6 receptor genes at human chromosome 11q13.3-14.1.
9412455 1997 Cloning of P2Y6 cDNAs and identification of a pseudogene: comparison of P2Y receptor subtype expression in bone and brain tissues.
9286708 1997 Chromosomal localization of the human P2y6 purinoceptor gene and phylogenetic analysis of the P2y purinoceptor family.
9268704 1997 Cloning of P2Y6 cDNAs and identification of a pseudogene: comparison of P2Y receptor subtype expression in bone and brain tissues.
8700127 1996 Uridine nucleotide selectivity of three phospholipase C-activating P2 receptors: identification of a UDP-selective, a UTP-selective, and an ATP- and UTP-specific receptor.
8670200 1996 Cloning, functional expression and tissue distribution of the human P2Y6 receptor.