Property Summary

Ligand Count 2
NCBI Gene PubMed Count 30
PubMed Score 881.04
PubTator Score 56.62

Knowledge Summary

Patent (1,475)

Expression

 GWAS Trait (1)

Gene RIF (19)

AA Sequence

MAANVSGAKSCPANFLAAADDKLSGFQGDFLWPILVVEFLVAVASNGLALYRFSIRKQRPWHPAVVFSVQ      1 - 70
LAVSDLLCALTLPPLAAYLYPPKHWRYGEAACRLERFLFTCNLLGSVIFITCISLNRYLGIVHPFFARSH     71 - 140
LRPKHAWAVSAAGWVLAALLAMPTLSFSHLKRPQQGAGNCSVARPEACIKCLGTADHGLAAYRAYSLVLA    141 - 210
GLGCGLPLLLTLAAYGALGRAVLRSPGMTVAEKLRVAALVASGVALYASSYVPYHIMRVLNVDARRRWST    211 - 280
RCPSFADIAQATAALELGPYVGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKST    281 - 350
GQALPLNATAAPKPSEPQSRELSQ                                                  351 - 374
//

Text Mined References (31)

PMID Year Title