Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.26
PubTator Score 4.62

Knowledge Summary

Patent (5,046)

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 2.7e-41
lung carcinoma 2844 5.2e-10
tuberculosis 1563 2.9e-05
osteosarcoma 7933 3.0e-04
interstitial cystitis 2299 1.0e-02

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.232 3.0e-04
tuberculosis -1.400 2.9e-05
interstitial cystitis 2.100 1.0e-02
lung carcinoma -1.500 5.2e-10
psoriasis 1.300 2.7e-41

Gene RIF (1)

PMID Text
18466763 The P2Y(10) receptor is the first receptor identified as a dual lysophospholipid receptor.

AA Sequence

MANLDKYTETFKMGSNSTSTAEIYCNVTNVKFQYSLYATTYILIFIPGLLANSAALWVLCRFISKKNKAI      1 - 70
IFMINLSVADLAHVLSLPLRIYYYISHHWPFQRALCLLCFYLKYLNMYASICFLTCISLQRCFFLLKPFR     71 - 140
ARDWKRRYDVGISAAIWIVVGTACLPFPILRSTDLNNNKSCFADLGYKQMNAVALVGMITVAELAGFVIP    141 - 210
VIIIAWCTWKTTISLRQPPMAFQGISERQKALRMVFMCAAVFFICFTPYHINFIFYTMVKETIISSCPVV    211 - 280
RIALYFHPFCLCLASLCCLLDPILYYFMASEFRDQLSRHGSSVTRSRLMSKESGSSMIG               281 - 339
//

Text Mined References (12)

PMID Year Title
24602016 2014 Lysophospholipid receptor nomenclature review: IUPHAR Review 8.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18466763 2008 Identification of the orphan GPCR, P2Y(10) receptor as the sphingosine-1-phosphate and lysophosphatidic acid receptor.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11004484 2000 Expression of purinergic receptors (ionotropic P2X1-7 and metabotropic P2Y1-11) during myeloid differentiation of HL60 cells.
10570953 1999 Human monocyte derived dendritic cells express functional P2X and P2Y receptors as well as ecto-nucleotidases.
9755289 1998 Receptors for purines and pyrimidines.