Property Summary

Ligand Count 26
NCBI Gene PubMed Count 12
PubMed Score 2.47
PubTator Score 4.62

Knowledge Summary

Patent (5,046)

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 2.7e-41
lung carcinoma 2843 5.2e-10
tuberculosis 2010 2.9e-05
osteosarcoma 7950 3.0e-04
interstitial cystitis 2312 1.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0

Expression

  Differential Expression (5)

Disease log2 FC p
interstitial cystitis 2.100 1.0e-02
lung carcinoma -1.500 5.2e-10
osteosarcoma -1.232 3.0e-04
psoriasis 1.300 2.7e-41
tuberculosis -1.400 2.9e-05

Gene RIF (1)

AA Sequence

MANLDKYTETFKMGSNSTSTAEIYCNVTNVKFQYSLYATTYILIFIPGLLANSAALWVLCRFISKKNKAI      1 - 70
IFMINLSVADLAHVLSLPLRIYYYISHHWPFQRALCLLCFYLKYLNMYASICFLTCISLQRCFFLLKPFR     71 - 140
ARDWKRRYDVGISAAIWIVVGTACLPFPILRSTDLNNNKSCFADLGYKQMNAVALVGMITVAELAGFVIP    141 - 210
VIIIAWCTWKTTISLRQPPMAFQGISERQKALRMVFMCAAVFFICFTPYHINFIFYTMVKETIISSCPVV    211 - 280
RIALYFHPFCLCLASLCCLLDPILYYFMASEFRDQLSRHGSSVTRSRLMSKESGSSMIG               281 - 339
//

Text Mined References (12)

PMID Year Title