Property Summary

NCBI Gene PubMed Count 94
PubMed Score 334.28
PubTator Score 353.56

Knowledge Summary

Patent (20,833)

Expression

  Differential Expression (20)

Disease log2 FC p
Rheumatoid Arthritis 1.700 3.6e-02
glioblastoma multiforme 1.200 1.1e-07
osteosarcoma 1.904 3.3e-02
ependymoma 1.100 4.7e-04
atypical teratoid / rhabdoid tumor -1.500 4.4e-02
medulloblastoma, large-cell -1.600 7.5e-04
acute quadriplegic myopathy -1.306 7.2e-04
tuberculosis and treatment for 3 months -1.300 6.4e-05
intraductal papillary-mucinous adenoma (... -2.400 2.6e-03
intraductal papillary-mucinous carcinoma... -2.700 3.2e-03
colon cancer -2.500 1.7e-03
ulcerative colitis -2.400 3.1e-07
interstitial cystitis -1.300 1.7e-04
adult high grade glioma 1.600 3.7e-03
group 4 medulloblastoma -2.500 2.1e-04
subependymal giant cell astrocytoma 1.938 3.2e-02
lung adenocarcinoma -1.800 1.7e-18
nasopharyngeal carcinoma -1.500 8.4e-03
spina bifida -1.409 4.1e-02
ovarian cancer -2.300 3.6e-07

Gene RIF (78)

PMID Text
26743169 Synergistic inhibition of both P2Y1 and P2Y12 adenosine diphosphate receptors by GLS-409 immediately attenuates platelet-mediated thrombosis and effectively blocks agonist-stimulated platelet aggregation irrespective of concomitant aspirin therapy.
26475857 P2Y1 couples to and activates TRPV4. PKC inhibitors prevented P2Y1 receptor activation of TRPV4.
25937122 Data indicate that ATP-evoked Hoechst 33258 uptake was dependent on activation of P2Y receptors P2Y1 and P2Y2.
25822790 crystal structures of the human P2Y1R in complex with a nucleotide antagonist MRS2500 at 2.7 A resolution, and with a non-nucleotide antagonist BPTU at 2.2 A resolution
25593131 Antibody EL2Ab binds to and exhibits P2Y1R-dependent function-blocking activity in the context of platelets.
25351961 Interaction of the HIV-1 gp120 with macrophages triggers an increase in ATP release that stimulates purinergic receptor P2X(1), P2X(7), and P2Y(1) proteins and facilitates HIV entry and subsequent stages of viral replication
25341729 This study shows that Up4A is a potent native agonist for P2Y1R and SK-channel activation in human and mouse colon.
25003238 The immunohistochemical results were reflected in the immunoblotting data P2RY1 receptors were detected at higher levels of expression in patient with cortical dysplasia with intractable epilepsy.
24998877 P2Y1 receptors are a potential pharmacological target leading smooth muscle relaxation to treat spasticity in colonic motor disorders.
24829920 These studies demonstrate a role for P2Y receptor activation in stimulation of ATP release.
24524250 The physiological impact of A87T mutation of the P2Y11 receptor derives from detrimental effects on P2Y1-P2Y11 receptor interaction.
24071464 Low ATP concentrations potentiated epinephrine-induced platelet aggregation that was abolished by P2Y1 antagonist MRS2500 suggesting P2Y1 receptor activation due to contaminating ADP.
23951072 H295R, a human adrenal cortex-derived cell line expresses a functional P2Y purinergic receptor for intracellular Ca(2)-mobilization. P2Y is linked to store-operated calcium entry activation, leading to Ca(2)-influx and cortisol secretion.
23849096 P2Y1 and P2Y12 genes were polymorphic in a Korean population; 3 intronic P2Y12 polymorphisms (i-139C>T, i-744T>C, i-801insA) were in complete linkage disequilibrium but not with the c.52C>T polymorphism; platelet aggregation in response to ADP associated with c.52C>T polymorphism but not with the 3 intronic polymorphisms or the P2Y1 c.1622A>T polymorphism
23828624 We think that allele G provides a protective effect in events of ventilatory stress. Moreover, the significant lack of P2Y1 G allele homozygotes in the SIDS group shows that respiratory response plays an important role in the etiology of SIDS
23326583 ATPgammaS induced COX-2 expression and PGE(2) production via a P2 receptor/PKC/NADPH oxidase/ROS/Jak2/STAT3/cPLA(2) signaling pathway in A549 cells.
22916275 Data describe a novel function of ARF6 in the internalization of P2Y purinoceptors and demonstrate the integral importance of this small GTPase upon platelet ADP receptor function.
22721490 Clopidogrel resistance was not associated with ADP receptor P2Y1 and P2Y12 gene polymorphisms.
22701645 Combined blockade of P2Y12, P2Y1 and PI3-kinase p110beta fully prevents platelet and leukocyte activation during hypothermic extracorporeal circulation.
22574824 Data indicate that single nucleotide polymorphisms (SNPs) in P2RY1 and P2RY12 are associated with on-aspirin platelet reactivity in patients with coronary artery disease (CAD).
22450808 Interaction of the HIV-1 gp120 with macrophages triggers an increase in ATP release that stimulates purinergic receptor P2X(1), P2X(7), and P2Y(1) proteins and facilitates HIV entry and subsequent stages of viral replication
22250198 results demonstrate a crosstalk between two metabotropic and one ionotropic purinergic receptor that regulates cAMP levels through adenylate cyclase 5 and modulates axonal elongation triggered by neurotropic factors and the PI3K-Akt-GSK3 pathway
22249129 Results indicate involvement of P2Y purinoceptors P2Y(1) and P2Y(6) receptors in ADP- and UDP-stimulated proliferation.
22079667 functional interaction of A2A and P2Y12 receptors on P2Y1 receptor
22052557 P2Y1 receptors are expressed in intracellular vesicles and sarcolemma of skeletal muscle fibers.
21643756 The role of P2RY1 in individuals from Latvian population is likely to be in platelet aggregation and thromboembolic diseases, and not as a significant contributing factor to the global metabolic syndrome, nor any association with myocardial infarction.
21632028 Activation of the P2Y1 receptor induces apoptosis and inhibits cell proliferation, implying a potentially novel target for prostate cancer.
21210088 P2Y1 expression plays an important role in ectopic bone formation in the spinal ligaments of patients with ossification of the posterior longitudinal ligament of the spine (OPLL)
20847060 Adenosine triphosphate (ATP) acts trophically in brain neurons via its purinergic receptor P2Y1 to regulate gene expression of synaptic transmission and transduction.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20586915 analysis of a novel Gi, P2Y-independent signaling pathway mediating Akt phosphorylation in response to thrombin receptors
20473398 Evaluation of antiplatelet agents in open flow systems demonstrates that inhibition of either ADP by apyrase or antagonism of P2X(1) signaling had no inhibitory effect on platelet accumulation.
20192270 Data show that compound 3 was active in changing intracelluular calcium in 1321N1 human astrocytoma cells stably expressing the hP2Y1 receptor.
20070609 These data describe a novel function of SNX1 in the regulation of P2Y(1) receptor recycling and suggest that SNX1 plays multiple roles in endocytic trafficking of G-protein coupled receptors.
20063989 Data show that ADP significantly increased VEGF, but not endostatin, release from platelets, and that both P2Y(1) and P2Y(12) receptor antagonism inhibited this release.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19934793 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19740098 genetic polymorphisms in ITGA2 and P2RY1 combine with plasma VWF:Ag levels to modulate baseline platelet reactivity in response to collagen plus EPI, while genetic differences in P2RY1 and GP1BA significantly effect platelet responses to collagen plus ADP
19740098 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19637098 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19132198 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18799799 In intact human vascular smooth muscle the association of the P2Y(1)R to membrane rafts, highlighting the role of this microdomain in P2Y(1)R signaling.
18502966 stress induces release of ATP, which in turn mediates Rho kinase activation through the P2Y1 receptor, resulting in the up-regulation of OPN [and] could play a significant role in alveolar bone resorption
18500760 The interaction between A(1) and P2Y(1) receptors may play an important role in the purinergic signaling cascade in astrocytes
18310463 Olfactory nerve terminals release not only glutamate, but also ATP, which activates P2Y(1) receptors.
18270199 analysis of constitutive and agonist-induced dimerizations of the P2Y1 receptor
18174464 ADP promotes human endothelial cell migration by activating P2Y1 receptor-mediated MAPK pathways, possibly contributing to reendothelialization and angiogenesis after vascular injury
18057028 These results highlight a role of P2Y(1)R in EGFR-dependent epithelial cell proliferation. P2Y(1)R could potentially mediate both trophic stimuli of basally released nucleotides and first-line mitogenic stimulation upon tissue damage.
17824841 oligomerization of the P2Y11 receptor with the P2Y1 receptor controls the internalization and ligand selectivity of the P2Y11 receptor
17559347 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17559347 Presence of the P2Y1 893CC genotype appears to confer an attenuated antiplatelet effect during aspirin treatment in healthy Chinese volunteers.
17095747 To determine if polymorphisms in P2X7 are associated with increased risk of TB. The 1513C allele increases susceptibility to extrapulmonary TB.
16848759 results suggest that the interaction of calmodulin with the P2Y1 C-terminal tail may regulate P2Y1-dependent platelet aggregation
16804093 This study therefore is the first to reveal distinct roles for PKC isoforms in the regulation of platelet P2Y receptor function and trafficking.
16741950 Stimulation of ARO cells evidenced a major involvement of P2Y1 and P2Y2 receptors in controlling the Hsp90 activation. P2Y1 and P2Y2 resulted significantly upregulated in sample biopsies from different thyroid tumors.
16634769 the A1622G dimorphism in P2Y1 is not associated with ADP-induced platelet activation/aggregation after treatment with clopidogrel
16581111 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16546137 We conclude that lipid rafts play a significant role in the regulation of P2X1 but not P2Y1 receptors in human platelets and that a reserve of non-functional P2X1 receptors may exist.
16267125 Induction of the osmolyte permeability in Plasmodium-infected erythrocytes involves autocrine purinoceptor signaling.
15665114 both P2Y(1) and P2Y(12) desensitize in human platelets; P2Y(12), but not P2Y(1), desensitization is mediated by GRKs
15602005 Agonist-induced P2Y1 receptor desensitization was accompanied by its internalization in platelets and transfected cells.
15590415 The P2Y1 has an exclusive vascular distribution.
15514209 Observational study of gene-disease association. (HuGE Navigator)
15509659 Results show that the two arginine residues (R333R334) in the carboxyl terminus of the human P2Y(1) ADP receptor are essential for G(q) coupling.
15496502 Basal activity of the P2Y(1) receptor is maintained by paracrine or autocrine release of receptor agonists.
15284110 ADP signaling through P2Y(1) may contribute to the initial stages of platelet adhesion and activation mediated by immobilized VWF, and through P2Y(12) to sustained thrombus formation.
15203713 both P2Y12 and P2Y1 contribute to ADP-potentiation of platelet-derived microparticles generation induced by collagen
15187029 Src kinase is activated through P2Y(1) but not P2Y(12)
15099288 Whereas P2RY1 antagonism did not affect collagen or thrombin-induced thrombin generation, P2RY12 antagonism did decrease both, suggesting that P2RY12, but not P2RY1, is responsible for the potentiation of agonist-induced platelet procoagulant activity.
14644082 Supports P2Y(12) as a drug target compared with P2Y(1).
12880424 Non-melanoma skin cancers express functional purinergic receptors and that P2X7 receptor agonists significantly reduce cell numbers in vitro.
12787128 Different purinergic receptors have different functional roles in human epidermis with P2Y1 and P2Y2 receptors controlling proliferation, while P2X5 and P2X7 receptors control early differentiation, terminal differentiation and death of keratinocytes.
12623443 the P2Y(1) purinoceptor and the P2Y(12)receptor appear to be involved in ADP-induced platelet shape change, an early phase of platelet activation that precedes aggregation
12603858 Human keratinocytes express multiple P2Y-receptors: evidence for functional P2Y1, P2Y2, and P2Y4 receptors.
12393588 immunolocalization of P2Y1 and TPalpha receptors in platelets revealed that while present at the platelet surface, both receptors were abundantly represented inside the platelet - in membranes of alpha-granules and elements of the open-canalicular system
12147294 Inhibition of platelet P2Y12 and alpha2A receptor signaling by cGMP-dependent protein kinase.
11690642 expression profile in human peripheral tissues and brain regions using PCR

AA Sequence

MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFYYLPAVYILVFIIGFLGNS      1 - 70
VAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDAMCKLQRFIFHVNLYGSIL     71 - 140
FLTCISAHRYSGVVYPLKSLGRLKKKNAICISVLVWLIVVVAISPILFYSGTGVRKNKTITCYDTTSDEY    141 - 210
LRSYFIYSMCTTVAMFCVPLVLILGCYGLIVRALIYKDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMK    211 - 280
TMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANL    281 - 350
QSKSEDMTLNILPEFKQNGDTSL                                                   351 - 373
//

Text Mined References (95)

PMID Year Title
26743169 2016 Synergistic Inhibition of Both P2Y1 and P2Y12 Adenosine Diphosphate Receptors As Novel Approach to Rapidly Attenuate Platelet-Mediated Thrombosis.
26475857 2015 P2Y1 Receptor Activation of the TRPV4 Ion Channel Enhances Purinergic Signaling in Satellite Glial Cells.
25937122 2015 Selective permeabilization of cervical cancer cells to an ionic DNA-binding cytotoxin by activation of P2Y receptors.
25822790 2015 Two disparate ligand-binding sites in the human P2Y1 receptor.
25593131 2015 Characterization of a novel function-blocking antibody targeted against the platelet P2Y1 receptor.
25341729 2014 Uridine adenosine tetraphosphate is a novel neurogenic P2Y1 receptor activator in the gut.
25003238 2014 Expression of astrocyte-related receptors in cortical dysplasia with intractable epilepsy.
24998877 2014 ?,?-meATP mimics the effects of the purinergic neurotransmitter in the human and rat colon.
24829920 2014 P2Y receptor modulation of ATP release in the urothelium.
24524250 2014 Alanine-(87)-threonine polymorphism impairs signaling and internalization of the human P2Y11 receptor, when co-expressed with the P2Y1 receptor.
24071464 2013 Nucleoside triphosphates inhibit ADP, collagen, and epinephrine-induced platelet aggregation: role of P2Y? and P2Y?? receptors.
23951072 2013 NCI-H295R, a human adrenal cortex-derived cell line, expresses purinergic receptors linked to Ca²?-mobilization/influx and cortisol secretion.
23849096 2013 Effect of P2Y1 and P2Y12 genetic polymorphisms on the ADP-induced platelet aggregation in a Korean population.
23828624 2013 Association between polymorphisms in the P2RY1 and SSTR2 genes and sudden infant death syndrome.
23382103 2013 Platelet proteome analysis reveals integrin-dependent aggregation defects in patients with myelodysplastic syndromes.
23326583 2013 ATP mediates NADPH oxidase/ROS generation and COX-2/PGE2 expression in A549 cells: role of P2 receptor-dependent STAT3 activation.
22916275 2012 ARF6-dependent regulation of P2Y receptor traffic and function in human platelets.
22721490 2013 Clopidogrel resistance in North Indian patients of coronary artery disease and lack of its association with platelet ADP receptors P2Y1 and P2Y12 gene polymorphisms.
22701645 2012 Combined blockade of ADP receptors and PI3-kinase p110? fully prevents platelet and leukocyte activation during hypothermic extracorporeal circulation.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
22574824 2012 P2RY1 and P2RY12 polymorphisms and on-aspirin platelet reactivity in patients with coronary artery disease.
22250198 2012 Adenylate cyclase 5 coordinates the action of ADP, P2Y1, P2Y13 and ATP-gated P2X7 receptors on axonal elongation.
22249129 2012 P2Y receptors regulate proliferation of human pancreatic duct epithelial cells.
22079667 2011 Functional interaction between purinergic receptors: effect of ligands for A2A and P2Y12 receptors on P2Y1 receptor function.
22052557 2012 Purinergic receptors expressed in human skeletal muscle fibres.
21643756 2012 Single nucleotide polymorphisms of the purinergic 1 receptor are not associated with myocardial infarction in a Latvian population.
21632028 2011 Activation of the P2Y1 receptor induces apoptosis and inhibits proliferation of prostate cancer cells.
21210088 2011 P2Y1 transient overexpression induced mineralization in spinal ligament cells derived from patients with ossification of the posterior longitudinal ligament of the cervical spine.
20847060 2010 ATP induces synaptic gene expressions in cortical neurons: transduction and transcription control via P2Y1 receptors.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20586915 2010 A G(i) -independent mechanism mediating Akt phosphorylation in platelets.
20473398 2010 P2Y12 or P2Y1 inhibitors reduce platelet deposition in a microfluidic model of thrombosis while apyrase lacks efficacy under flow conditions.
20192270 2010 Structure-activity relationship of (N)-Methanocarba phosphonate analogues of 5'-AMP as cardioprotective agents acting through a cardiac P2X receptor.
20070609 2010 Regulation of P2Y1 receptor traffic by sorting Nexin 1 is retromer independent.
20063989 2010 The effect of P2Y-mediated platelet activation on the release of VEGF and endostatin from platelets.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19934793 2010 Besides CYP2C19*2, the variant allele CYP2C9*3 is associated with higher on-clopidogrel platelet reactivity in patients on dual antiplatelet therapy undergoing elective coronary stent implantation.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19740098 2009 Genetics of platelet reactivity in normal, healthy individuals.
19637098 2009 Ticagrelor yields consistent dose-dependent inhibition of ADP-induced platelet aggregation in patients with atherosclerotic disease regardless of genotypic variations in P2RY12, P2RY1, and ITGB3.
19132198 2009 Lack of association between aspirin responsiveness and seven candidate gene haplotypes in patients with symptomatic vascular disease.
18799799 2008 P2Y1 receptor activation elicits its partition out of membrane rafts and its rapid internalization from human blood vessels: implications for receptor signaling.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18502966 2008 Mechanical stress induces osteopontin via ATP/P2Y1 in periodontal cells.
18500760 2008 Regulation of A1 adenosine receptor functioning induced by P2Y1 purinergic receptor activation in human astroglial cells.
18310463 2008 New evidence for purinergic signaling in the olfactory bulb: A2A and P2Y1 receptors mediate intracellular calcium release in astrocytes.
18270199 2008 Constitutive and agonist-induced dimerizations of the P2Y1 receptor: relationship to internalization and scaffolding.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18174464 2008 ADP stimulates human endothelial cell migration via P2Y1 nucleotide receptor-mediated mitogen-activated protein kinase pathways.
18088087 2008 Phosphoproteome of resting human platelets.
18057028 2007 Nucleotide P2Y1 receptor regulates EGF receptor mitogenic signaling and expression in epithelial cells.
17824841 2008 Hetero-oligomerization of the P2Y11 receptor with the P2Y1 receptor controls the internalization and ligand selectivity of the P2Y11 receptor.
17559347 2007 Frequency of genetic polymorphisms of COX1, GPIIIa and P2Y1 in a Chinese population and association with attenuated response to aspirin.
17095747 2007 A polymorphism in the P2X7 gene increases susceptibility to extrapulmonary tuberculosis.
16848759 2006 Calmodulin interacts with the platelet ADP receptor P2Y1.
16804093 2006 Distinct roles for protein kinase C isoforms in regulating platelet purinergic receptor function.
16741950 2006 Nucleotide receptors stimulation by extracellular ATP controls Hsp90 expression through APE1/Ref-1 in thyroid cancer cells: a novel tumorigenic pathway.
16634769 2006 P2Y1 gene A1622G dimorphism is not associated with adenosine diphosphate-induced platelet activation and aggregation after administration of a single high dose of clopidogrel.
16581111 2007 Genetic polymorphisms of the platelet receptors P2Y(12), P2Y(1) and GP IIIa and response to aspirin and clopidogrel.
16546137 2006 Differential sensitivity of human platelet P2X1 and P2Y1 receptors to disruption of lipid rafts.
16267125 2006 Purinoceptors are involved in the induction of an osmolyte permeability in malaria-infected and oxidized human erythrocytes.
15665114 2005 P2Y1 and P2Y12 receptors for ADP desensitize by distinct kinase-dependent mechanisms.
15602005 2005 Differential regulation and relocalization of the platelet P2Y receptors after activation: a way to avoid loss of hemostatic properties?
15590415 Co-localization of P2Y1 receptor and NTPDase1/CD39 within caveolae in human placenta.
15514209 2005 Dimorphism in the P2Y1 ADP receptor gene is associated with increased platelet activation response to ADP.
15509659 2005 Arg333 and Arg334 in the COOH terminus of the human P2Y1 receptor are crucial for Gq coupling.
15496502 2005 Regulation of P2Y1 receptor-mediated signaling by the ectonucleoside triphosphate diphosphohydrolase isozymes NTPDase1 and NTPDase2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15284110 2004 Distinct roles of ADP receptors in von Willebrand factor-mediated platelet signaling and activation under high flow.
15203713 2004 Collagen-induced generation of platelet-derived microparticles in whole blood is dependent on ADP released from red blood cells and calcium ions.
15187029 2004 Reciprocal cross-talk between P2Y1 and P2Y12 receptors at the level of calcium signaling in human platelets.
15099288 2004 Role of protease-activated and ADP receptor subtypes in thrombin generation on human platelets.
14742685 2004 Agonist binding and Gq-stimulating activities of the purified human P2Y1 receptor.
14644082 2003 The relative importance of the ADP receptors, P2Y12 and P2Y1, in thrombin-induced platelet activation.
12880424 2003 Expression of purinergic receptors in non-melanoma skin cancers and their functional roles in A431 cells.
12871508 2003 Quantification of ADP and ATP receptor expression in human platelets.
12787128 2003 Purinergic receptors are part of a functional signaling system for proliferation and differentiation of human epidermal keratinocytes.
12623443 2003 Both the ADP receptors P2Y1 and P2Y12, play a role in controlling shape change in human platelets.
12603858 2003 Human keratinocytes express multiple P2Y-receptors: evidence for functional P2Y1, P2Y2, and P2Y4 receptors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393588 2003 Immunolocalization of P2Y1 and TPalpha receptors in platelets showed a major pool associated with the membranes of alpha -granules and the open canalicular system.
12147294 2002 Inhibition of platelet P2Y12 and alpha2A receptor signaling by cGMP-dependent protein kinase.
11904146 2002 ADP-evoked phospholipase C stimulation and adenylyl cyclase inhibition in glioma C6 cells occur through two distinct nucleotide receptors, P2Y(1) and P2Y(12).
11690642 2001 Expression pattern of human P2Y receptor subtypes: a quantitative reverse transcription-polymerase chain reaction study.
11578839 2001 Changes in P2Y and P2X purinoceptors in reactive glia following axonal degeneration in the rat optic nerve.
11390975 2001 Heteromeric association creates a P2Y-like adenosine receptor.
11159687 2001 Two subtypes of G protein-coupled nucleotide receptors, P2Y(1) and P2Y(2) are involved in calcium signalling in glioma C6 cells.
9671706 1998 A C-terminal motif found in the beta2-adrenergic receptor, P2Y1 receptor and cystic fibrosis transmembrane conductance regulator determines binding to the Na+/H+ exchanger regulatory factor family of PDZ proteins.
9442040 1998 Molecular basis for ADP-induced platelet activation. II. The P2Y1 receptor mediates ADP-induced intracellular calcium mobilization and shape change in platelets.
9268704 1997 Cloning of P2Y6 cDNAs and identification of a pseudogene: comparison of P2Y receptor subtype expression in bone and brain tissues.
9039850 1996 Structural characterization and fine chromosomal mapping of the human P2Y1 purinergic receptor gene (P2RY1).
9038354 1997 The P2Y1 receptor is an ADP receptor antagonized by ATP and expressed in platelets and megakaryoblastic cells.
8666290 1996 Cloning and sequencing of a human cDNA encoding endothelial P2Y1 purinoceptor.
8630005 1996 Cloning and tissue distribution of the human P2Y1 receptor.
8579591 1996 Cloning and chromosomal localization of the human P2Y1 purinoceptor.