Property Summary

NCBI Gene PubMed Count 79
PubMed Score 525.65
PubTator Score 437.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Autistic Disorder 364 0.0 0.8

Expression

  Differential Expression (29)

 IMPC Phenotype (1)

Gene RIF (48)

AA Sequence

MGAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQANGSAPAADKE      1 - 70
EPAAAGSGAASPSAAEKGEPAAAAAPEAGASPVEKEAPAEGEAAEPGSPTAAEGEAASAASSTSSPKAED     71 - 140
GATPSPSNETPKKKKKRFSFKKSFKLSGFSFKKNKKEAGEGGEAEAPAAEGGKDEAAGGAAAAAAEAGAA    141 - 210
SGEQAAAPGEEAAAGEEGAAGGDPQEAKPQEAAVAPEKPPASDETKAAEEPSKVEEKKAEEAGASAAACE    211 - 280
APSAAGPGAPPEQEAAPAEEPAAAAASSACAAPSQEAQPECSPEAPPAEAAE                      281 - 332
//

Text Mined References (89)

PMID Year Title