Property Summary

NCBI Gene PubMed Count 73
Grant Count 187
R01 Count 109
Funding $28,328,661.88
PubMed Score 512.24
PubTator Score 437.45

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P29966 E1P560 Q2LA83 Q5TDB7 MARCKS
Symbols MACS
80K-L
PKCSL
PRKCSL

Gene

Gene RIF (42)

PMID Text
26722462 Knockdown of MARCKS in HepG2 cells reduced cell migration and invasion, but not cell proliferation.
26528715 MARCKS knockdown arrested VSMC cell cycle by decreasing KIS expression. Decreased KIS expression resulted in nuclear trapping of p27kip1 in VSMCs.
26470026 A novel role for MARCKS in regulating nuclear functions such as gene expression.
26450120 MARCKS upregulation increases vascular smooth muscle cell motility by activation of Rac1 and Cdc42, promoting neointima formation.
26015406 unresponsiveness of breast cancer to paclitaxel treatment is, at least in part, mediated by phospho-MARCKS
25757715 MARCKS and PPP1R9A might contribute to spine loss in schizophrenia and bipolar disorder through their interactions.
25524703 A key role of the effector domain of MARCKS in terms of cellular response, particularly to radiation: the importance of MARCKS phosphorylation status for its subcellular localization in lung cancer.
25515270 isotype delta-PKC is responsible for myristoylated alanine-rich C-kinase substrate (MARCKS) phosphorylation in human neutrophils following f-Met-Leu-Phe stimulation and MARCKS phosphorylation is essential for neutrophil migration and adhesion.
25318062 results suggest a key role for MARCKS PSD in cancer disease and provide a unique strategy for inhibiting the activity of MARCKS PSD as a treatment for lung cancer.
25179733 MARCKS overexpression was observed in several drug-resistant human myeloma cell lines and in drug-resistant primary multiple myeloma samples.
More...

AA Sequence

MGAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQANGSAPAADKE      1 - 70
EPAAAGSGAASPSAAEKGEPAAAAAPEAGASPVEKEAPAEGEAAEPGSPTAAEGEAASAASSTSSPKAED     71 - 140
GATPSPSNETPKKKKKRFSFKKSFKLSGFSFKKNKKEAGEGGEAEAPAAEGGKDEAAGGAAAAAAEAGAA    141 - 210
SGEQAAAPGEEAAAGEEGAAGGDPQEAKPQEAAVAPEKPPASDETKAAEEPSKVEEKKAEEAGASAAACE    211 - 280
APSAAGPGAPPEQEAAPAEEPAAAAASSACAAPSQEAQPECSPEAPPAEAAE                      281 - 332
//

Publication (83)

PMID Year Title
26722462 2015 miR-34c-3p inhibits cell proliferation, migration and invasion of hepatocellular carcinoma by targeting MARCKS.
26528715 2015 MARCKS Signaling Differentially Regulates Vascular Smooth Muscle and Endothelial Cell Proliferation through a KIS-, p27kip1- Dependent Mechanism.
26470026 2015 The Effector Domain of MARCKS Is a Nuclear Localization Signal that Regulates Cellular PIP2 Levels and Nuclear PIP2 Localization.
26450120 2015 Myristoylated Alanine-Rich Protein Kinase Substrate (MARCKS) Regulates Small GTPase Rac1 and Cdc42 Activity and Is a Critical Mediator of Vascular Smooth Muscle Cell Migration in Intimal Hyperplasia Formation.
26015406 2015 Elevated MARCKS phosphorylation contributes to unresponsiveness of breast cancer to paclitaxel treatment.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25757715 2015 Altered prefrontal cortical MARCKS and PPP1R9A mRNA expression in schizophrenia and bipolar disorder.
25524703 2015 Targeting the effector domain of the myristoylated alanine rich C-kinase substrate enhances lung cancer radiation sensitivity.
25515270 2015 In Vitro Neutrophil Migration Requires Protein Kinase C-Delta (?-PKC)-Mediated Myristoylated Alanine-Rich C-Kinase Substrate (MARCKS) Phosphorylation.
25318062 2014 Targeting myristoylated alanine-rich C kinase substrate phosphorylation site domain in lung cancer. Mechanisms and therapeutic implications.
More...