Property Summary

NCBI Gene PubMed Count 38
Grant Count 10
R01 Count 7
Funding $1,580,473.11
PubMed Score 100.75
PubTator Score 93.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Gene RIF (19)

PMID Text
26169984 Novel interactions of TPPII, p53, and SIRT7 presented in this study might contribute to the knowledge of the regulatory effects of these proteins on apoptotic pathways and to the understanding mechanisms of aging and lifespan regulation.
26041847 TPP2 mediates many important cellular functions by controlling ERK1 and ERK2 phosphorylation.
25525876 Study found that autosomal recessive TPP2 mutations cause recurrent infections, autoimmunity, and neurodevelopmental delay in humans.
25414442 Early-onset Evans syndrome, immunodeficiency, and premature immunosenescence associated with TPP2 deficiency have been described in two consanguineous siblings.
25303791 TPPII, MYBBP1A and CDK2 form a protein-protein interaction network.
22986808 Study showed that overexpression of Tripeptidyl peptidase II (TPP2) occurs frequently during oral carcinogenesis and might be associated with the progression of Oral Squamous Cell Carcinoma (OSCC) via Spindle Assembly Checkpoint(SAC) activation.
22483107 obtained a 3D structure of the human TPPII
22266401 Previously unknown differences between TPP II orthologues and subtilisin as well as features that might be conserved within the entire family of subtilisin-like serine peptidases.
21771670 Current knowledge about TPPII with a focus on structural aspects.
21134372 Results suggest an important function of TPPII in the maintenance of viral growth and may have implications for anti-viral therapy.
More...

AA Sequence

MATAATEEPFPFHGLLPKKETGAASFLCRYPEYDGRGVLIAVLDTGVDPGAPGMQVTTDGKPKIVDIIDT      1 - 70
TGSGDVNTATEVEPKDGEIVGLSGRVLKIPASWTNPSGKYHIGIKNGYDFYPKALKERIQKERKEKIWDP     71 - 140
VHRVALAEACRKQEEFDVANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGEVWRACI    141 - 210
DSNEDGDLSKSTVLRNYKEAQEYGSFGTAEMLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEP    211 - 280
ERNGVAPGAQILSIKIGDTRLSTMETGTGLIRAMIEVINHKCDLVNYSYGEATHWPNSGRICEVINEAVW    281 - 350
KHNIIYVSSAGNNGPCLSTVGCPGGTTSSVIGVGAYVSPDMMVAEYSLREKLPANQYTWSSRGPSADGAL    351 - 420
GVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALILSGLKANNIDYTVHSVRRALENTAVKAD    421 - 490
NIEVFAQGHGIIQVDKAYDYLVQNTSFANKLGFTVTVGNNRGIYLRDPVQVAAPSDHGVGIEPVFPENTE    491 - 560
NSEKISLQLHLALTSNSSWVQCPSHLELMNQCRHINIRVDPRGLREGLHYTEVCGYDIASPNAGPLFRVP    561 - 630
ITAVIAAKVNESSHYDLAFTDVHFKPGQIRRHFIEVPEGATWAEVTVCSCSSEVSAKFVLHAVQLVKQRA    631 - 700
YRSHEFYKFCSLPEKGTLTEAFPVLGGKAIEFCIARWWASLSDVNIDYTISFHGIVCTAPQLNIHASEGI    701 - 770
NRFDVQSSLKYEDLAPCITLKNWVQTLRPVSAKTKPLGSRDVLPNNRQLYEMVLTYNFHQPKSGEVTPSC    771 - 840
PLLCELLYESEFDSQLWIIFDQNKRQMGSGDAYPHQYSLKLEKGDYTIRLQIRHEQISDLERLKDLPFIV    841 - 910
SHRLSNTLSLDIHENHSFALLGKKKSSNLTLPPKYNQPFFVTSLPDDKIPKGAGPGCYLAGSLTLSKTEL    911 - 980
GKKADVIPVHYYLIPPPTKTKNGSKDKEKDSEKEKDLKEEFTEALRDLKIQWMTKLDSSDIYNELKETYP    981 - 1050
NYLPLYVARLHQLDAEKERMKRLNEIVDAANAVISHIDQTALAVYIAMKTDPRPDAATIKNDMDKQKSTL   1051 - 1120
VDALCRKGCALADHLLHTQAQDGAISTDAEGKEEEGESPLDSLAETFWETTKWTDLFDNKVLTFAYKHAL   1121 - 1190
VNKMYGRGLKFATKLVEEKPTKENWKNCIQLMKLLGWTHCASFTENWLPIMYPPDYCVF              1191 - 1249
//

Text Mined References (43)

PMID Year Title
26169984 2015 Novel protein-protein interactions of TPPII, p53, and SIRT7.
26041847 2015 Tripeptidyl Peptidase II Mediates Levels of Nuclear Phosphorylated ERK1 and ERK2.
25525876 2014 Dual proteolytic pathways govern glycolysis and immune competence.
25416956 2014 A proteome-scale map of the human interactome network.
25414442 2015 Early-onset Evans syndrome, immunodeficiency, and premature immunosenescence associated with tripeptidyl-peptidase II deficiency.
25303791 2014 TPPII, MYBBP1A and CDK2 form a protein-protein interaction network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22986808 2013 Tripeptidyl peptidase II in human oral squamous cell carcinoma.
22483107 2012 The structure of human tripeptidyl peptidase II as determined by a hybrid approach.
22266401 2012 Exploring the active site of tripeptidyl-peptidase II through studies of pH dependence of reaction kinetics.
More...