Property Summary

NCBI Gene PubMed Count 17
PubMed Score 80.55
PubTator Score 1289.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.400 3.9e-05
astrocytic glioma -1.400 1.3e-02
Astrocytoma, Pilocytic -1.200 2.7e-05
atypical teratoid / rhabdoid tumor -1.500 8.0e-07
ependymoma -1.100 4.3e-02
gastric cancer 1.200 4.3e-04
glioblastoma -1.300 1.2e-06
group 4 medulloblastoma -1.200 3.1e-03
hepatocellular carcinoma 1.200 2.5e-03
malignant mesothelioma -1.100 1.4e-05
medulloblastoma, large-cell -1.700 3.5e-05
oligodendroglioma -1.100 3.3e-02
osteosarcoma -1.068 1.0e-02
ovarian cancer 1.200 8.8e-05
Pick disease 1.200 3.0e-02
primitive neuroectodermal tumor -1.200 8.0e-04

 GO Process (1)

Gene RIF (6)

AA Sequence

MTSRFRLPAGRTYNVRASELARDRQHTEVVCNILLLDNTVQAFKVNKHDQGQVLLDVVFKHLDLTEQDYF      1 - 70
GLQLADDSTDNPRWLDPNKPIRKQLKRGSPYSLNFRVKFFVSDPNKLQEEYTRYQYFLQIKQDILTGRLP     71 - 140
CPSNTAALLASFAVQSELGDYDQSENLSGYLSDYSFIPNQPQDFEKEIAKLHQQHIGLSPAEAEFNYLNT    141 - 210
ARTLELYGVEFHYARDQSNNEIMIGVMSGGILIYKNRVRMNTFPWLKIVKISFKCKQFFIQLRKELHESR    211 - 280
ETLLGFNMVNYRACKNLWKACVEHHTFFRLDRPLPPQKNFFAHYFTLGSKFRYCGRTEVQSVQYGKEKAN    281 - 350
KDRVFARSPSKPLARKLMDWEVVSRNSISDDRLETQSLPSRSPPGTPNHRNSTFTQEGTRLRPSSVGHLV    351 - 420
DHMVHTSPSEVFVNQRSPSSTQANSIVLESSPSQETPGDGKPPALPPKQSKKNSWNQIHYSHSQQDLESH    421 - 490
INETFDIPSSPEKPTPNGGIPHDNLVLIRMKPDENGRFGFNVKGGYDQKMPVIVSRVAPGTPADLCVPRL    491 - 560
NEGDQVVLINGRDIAEHTHDQVVLFIKASCERHSGELMLLVRPNAVYDVVEEKLENEPDFQYIPEKAPLD    561 - 630
SVHQDDHSLRESMIQLAEGLITGTVLTQFDQLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVILKG    631 - 700
NEDYINANYINMEIPSSSIINQYIACQGPLPHTCTDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEP    701 - 770
TGSSSYGCYQVTCHSEEGNTAYIFRKMTLFNQEKNESRPLTQIQYIAWPDHGVPDDSSDFLDFVCHVRNK    771 - 840
RAGKEEPVVVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQYRFVCEAILK    841 - 910
VYEEGFVKPLTTSTNK                                                          911 - 926
//

Text Mined References (19)

PMID Year Title