Property Summary

NCBI Gene PubMed Count 49
Grant Count 201
R01 Count 118
Funding $25,679,828.28
PubMed Score 258.14
PubTator Score 346.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
medulloblastoma, large-cell 1.400 0.000
Atopic dermatitis 1.100 0.005
group 3 medulloblastoma -1.100 0.033
psoriasis 1.200 0.000
ovarian cancer 1.500 0.000

Synonym

Accession P29016 Q5TDK9 Q5TDL0 Q9UMM2
Symbols R1
CD1
CD1A

Gene

PDB

1GZP   1GZQ   1UQS   2H26   3OV6   3T8X   4ONO   5C9J  

Gene RIF (29)

PMID Text
26621732 the development of polyvalent complexes of CD1b proteins and carbohydrate backbones (dextramers) and their use in identifying CD1b autoreactive T cells from human donors.
24556395 [review] Humans express both Group 1 (CD1a, CD1b and CD1c) and Group 2 (CD1d) CD1 molecules with nonredundant functions in response to the presentation of endogenous lipids.
23766460 Dysregulated CD1 profile in myeloid dendritic cells in CVID is normalized by IVIg treatment.
23677998 for isoforms CD1b through CD1e, our simulations show the near-complete collapse of the hydrophobic cavities in the absence of the antigen. This event results from the spontaneous closure of the binding domain entrance, flanked by two alpha-helices.
23468110 Molecular mechanisms by which CD1b captures distinct classes of self- and mycobacterial antigens are reviewed. Review.
22782895 Deciphering the role of CD1e protein in mycobacterial phosphatidyl-myo-inositol mannosides (PIM) processing for presentation by CD1b to T lymphocytes
22087000 CD1b has a mechanism for presenting either two small or one large lipid, allowing presentation of antigens with an unusually broad range of chain lengths.
21807869 a cognate mechanism whereby CD1b-glycolipid complexes bind to TCRs.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20212510 The DC-SIGNlow/CD86high population is characterized by a reduced CD1b expression that correlates with a reduced iMtb-specific lymphocyte proliferation together with an enhanced mixed leukocyte reaction.
More...

AA Sequence

MLLLPFQLLAVLFPGGNSEHAFQGPTSFHVIQTSSFTNSTWAQTQGSGWLDDLQIHGWDSDSGTAIFLKP      1 - 70
WSKGNFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQMKYPFEIQGIAGCELHSGGAIVSFLRGALGGLD     71 - 140
FLSVKNASCVPSPEGGSRAQKFCALIIQYQGIMETVRILLYETCPRYLLGVLNAGKADLQRQVKPEAWLS    141 - 210
SGPSPGPGRLQLVCHVSGFYPKPVWVMWMRGEQEQQGTQLGDILPNANWTWYLRATLDVADGEAAGLSCR    211 - 280
VKHSSLEGQDIILYWRNPTSIGSIVLAIIVPSLLLLLCLALWYMRRRSYQNIP                     281 - 333
//

Text Mined References (51)

PMID Year Title
26621732 2016 Human autoreactive T cells recognize CD1b and phospholipids.
24556395 2014 Lipid presentation by human CD1 molecules and the diverse T cell populations that respond to them.
23981064 2014 Mycobacterium tuberculosis infection of human dendritic cells decreases integrin expression, adhesion and migration to chemokines.
23766460 2013 Dysregulated CD1 profile in myeloid dendritic cells in CVID is normalized by IVIg treatment.
23677998 2013 Dynamics of the antigen-binding grooves in CD1 proteins: reversible hydrophobic collapse in the lipid-free state.
23468110 2013 CD1a, CD1b, and CD1c in immunity against mycobacteria.
22782895 2012 Deciphering the role of CD1e protein in mycobacterial phosphatidyl-myo-inositol mannosides (PIM) processing for presentation by CD1b to T lymphocytes.
22087000 2011 Discovery of deoxyceramides and diacylglycerols as CD1b scaffold lipids among diverse groove-blocking lipids of the human CD1 system.
21807869 2011 CD1b tetramers bind ?? T cell receptors to identify a mycobacterial glycolipid-reactive T cell repertoire in humans.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
More...