Property Summary

NCBI Gene PubMed Count 47
Grant Count 17
R01 Count 7
Funding $1,071,610.16
PubMed Score 45.39
PubTator Score 47.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
psoriasis -1.100 0.006
glioblastoma 1.400 0.004
osteosarcoma 2.617 0.017
medulloblastoma, large-cell 1.100 0.000
adrenocortical carcinoma 1.904 0.002
non-small cell lung cancer 1.104 0.000
lung cancer 3.900 0.000
active ulcerative colitis -1.540 0.010
interstitial cystitis -1.100 0.036
adult high grade glioma 2.100 0.000
ovarian cancer -2.900 0.000
Gaucher disease type 3 -2.600 0.034

Gene RIF (22)

PMID Text
26311318 Low HOXD10 promotes migration and invasion in gastric cancer.
26260613 These results suggested that HOXD10 may be a putative suppressor gene and can act as a prognostic marker and potentially a novel therapeutic target for cholangiocellular carcinoma.
25301728 POU2F1 activity regulates HOXD10 and HOXD11 gene expression in head and neck squamous cell carcinoma, promoting a proliferative and invasive phenotype.
25081374 Downregulation of the HOXD10 gene expression was associated with breast cancer.
25010866 HOXD10 expression varies by stage of disease and produces differential effects in head and neck squamous cell carcinoma.
24573354 KLF4 and HOXD10 were identified as direct targets of miR-10b in bladder cancer cells
24376640 MicroRNA-10b promotes nucleus pulposus cell proliferation through RhoC-Akt pathway by targeting HOXD10 in intervetebral disc degeneration.
24305689 miR-23a was upregulated in glioma. This overexpression promoted glioma cell invasion, probably by modulating MMP-14 via directly inhibiting the expression of HOXD10.
24219032 It is a member of the HOX gene family. HOX genes are the main regulatory genes that directly influence organogenesis and maintain the function of differentiated tissues
23670532 downregulation of HOXD10 expression by miR-10b overexpression may induce an increase of pro-metastatic gene products, such as MMP14 and RHOC, and contribute to the acquisition of metastatic phenotypes in epithelial ovarian cancer cells
More...

AA Sequence

MSFPNSSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADMGTYGMQTCGLLPSLAKREVNHQNMGMN      1 - 70
VHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTTNIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCP     71 - 140
VENPEVPVPGYFRLSQTYATGKTQEYNNSPEGSSTVMLQLNPRGAAKPQLSAAQLQMEKKMNEPVSGQEP    141 - 210
TKVSQVESPEAKGGLPEERSCLAEVSVSSPEVQEKESKEEIKSDTPTSNWLTAKSGRKKRCPYTKHQTLE    211 - 280
LEKEFLFNMYLTRERRLEISKSVNLTDRQVKIWFQNRRMKLKKMSRENRIRELTANLTFS              281 - 340
//

Publication (47)

PMID Year Title
26311318 2015 MicroRNA-10b promotes migration and invasion through Hoxd10 in human gastric cancer.
26260613 2015 HOXD10 acts as a tumor-suppressive factor via inhibition of the RHOC/AKT/MAPK pathway in human cholangiocellular carcinoma.
25301728 2014 POU2F1 activity regulates HOXD10 and HOXD11 promoting a proliferative and invasive phenotype in head and neck cancer.
25081374 2014 HOXD10 expression in human breast cancer.
25010866 2014 The roles of HOXD10 in the development and progression of head and neck squamous cell carcinoma (HNSCC).
24573354 2014 MicroRNA-10b promotes migration and invasion through KLF4 and HOXD10 in human bladder cancer.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24376640 2013 MicroRNA-10b promotes nucleus pulposus cell proliferation through RhoC-Akt pathway by targeting HOXD10 in intervetebral disc degeneration.
24305689 2013 Targeting microRNA-23a to inhibit glioma cell invasion via HOXD10.
24219032 2014 miR-224 promotion of cell migration and invasion by targeting Homeobox D 10 gene in human hepatocellular carcinoma.
More...