Property Summary

NCBI Gene PubMed Count 51
PubMed Score 51.28
PubTator Score 47.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
active ulcerative colitis -1.540 1.0e-02
adrenocortical carcinoma 1.904 2.1e-03
adult high grade glioma 1.100 3.0e-03
Gaucher disease type 3 -2.600 3.4e-02
glioblastoma 1.400 3.9e-03
interstitial cystitis -1.100 3.6e-02
lung cancer 3.900 6.6e-07
medulloblastoma, large-cell 1.100 1.0e-04
non-small cell lung cancer 1.104 1.5e-06
osteosarcoma 2.617 1.7e-02
ovarian cancer -2.900 7.8e-11
psoriasis -1.100 5.7e-03

Gene RIF (26)

AA Sequence

MSFPNSSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADMGTYGMQTCGLLPSLAKREVNHQNMGMN      1 - 70
VHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTTNIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCP     71 - 140
VENPEVPVPGYFRLSQTYATGKTQEYNNSPEGSSTVMLQLNPRGAAKPQLSAAQLQMEKKMNEPVSGQEP    141 - 210
TKVSQVESPEAKGGLPEERSCLAEVSVSSPEVQEKESKEEIKSDTPTSNWLTAKSGRKKRCPYTKHQTLE    211 - 280
LEKEFLFNMYLTRERRLEISKSVNLTDRQVKIWFQNRRMKLKKMSRENRIRELTANLTFS              281 - 340
//

Text Mined References (51)

PMID Year Title