Property Summary

NCBI Gene PubMed Count 23
Grant Count 1
R01 Count 1
Funding $43,079.43
PubMed Score 69.29
PubTator Score 17.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
nephrosclerosis -1.690 0.023
pancreatic ductal adenocarcinoma liver m... -1.326 0.014
colon cancer -1.800 0.046
ulcerative colitis -1.400 0.000
chronic rhinosinusitis -1.639 0.015
cystic fibrosis and chronic rhinosinusit... -1.319 0.049
psoriasis -1.500 0.000

Synonym

Accession P28332 B3KS45 Q58F53
Symbols ADH-5

Gene

PANTHER Protein Class (2)

 Grant Application (1)

Gene RIF (7)

PMID Text
23468174 common ADH variants conferred risk for both schizophrenia in African-Americans and autism in European-Americans.
22690706 Results show that polymorphism of ADH6 gene leads to heavy drinking in women.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
17185388 Observational study of gene-disease association. (HuGE Navigator)
16685648 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MCTTGQVIRCKAAILWKPGAPFSIEEVEVAPPKAKEVRIKVVATGLCGTEMKVLGSKHLDLLYPTILGHE      1 - 70
GAGIVESIGEGVSTVKPGDKVITLFLPQCGECTSCLNSEGNFCIQFKQSKTQLMSDGTSRFTCKGKSIYH     71 - 140
FGNTSTFCEYTVIKEISVAKIDAVAPLEKVCLISCGFSTGFGAAINTAKVTPGSTCAVFGLGGVGLSVVM    141 - 210
GCKAAGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGIDFCFEAIGNLDVLAAAL    211 - 280
ASCNESYGVCVVVGVLPASVQLKISGQLFFSGRSLKGSVFGGWKSRQHIPKLVADYMAEKLNLDPLITHT    281 - 350
LNLDKINEAVELMKTGKW                                                        351 - 368
//

Text Mined References (25)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23534349 2013 Generalization of variants identified by genome-wide association studies for electrocardiographic traits in African Americans.
23468174 2013 Association between common alcohol dehydrogenase gene (ADH) variants and schizophrenia and autism.
23456092 2013 Extended genetic effects of ADH cluster genes on the risk of alcohol dependence: from GWAS to replication.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22690706 2012 Association of alcohol dehydrogenase polymorphisms and life-style factors with excessive alcohol intake within the Spanish population (EPIC-Spain).
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19698717 2009 Functional variants in ADH1B and ALDH2 coupled with alcohol and smoking synergistically enhance esophageal cancer risk.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
More...