Property Summary

NCBI Gene PubMed Count 24
PubMed Score 71.75
PubTator Score 17.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
chronic rhinosinusitis -1.639 1.5e-02
colon cancer -1.800 4.6e-02
cystic fibrosis and chronic rhinosinusit... -1.319 4.9e-02
nephrosclerosis -1.109 1.4e-02
pancreatic ductal adenocarcinoma liver m... -1.326 1.4e-02
psoriasis -1.500 3.8e-30
ulcerative colitis -1.400 2.4e-04

 GWAS Trait (1)

Gene RIF (8)

AA Sequence

MCTTGQVIRCKAAILWKPGAPFSIEEVEVAPPKAKEVRIKVVATGLCGTEMKVLGSKHLDLLYPTILGHE      1 - 70
GAGIVESIGEGVSTVKPGDKVITLFLPQCGECTSCLNSEGNFCIQFKQSKTQLMSDGTSRFTCKGKSIYH     71 - 140
FGNTSTFCEYTVIKEISVAKIDAVAPLEKVCLISCGFSTGFGAAINTAKVTPGSTCAVFGLGGVGLSVVM    141 - 210
GCKAAGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGIDFCFEAIGNLDVLAAAL    211 - 280
ASCNESYGVCVVVGVLPASVQLKISGQLFFSGRSLKGSVFGGWKSRQHIPKLVADYMAEKLNLDPLITHT    281 - 350
LNLDKINEAVELMKTGKW                                                        351 - 368
//

Text Mined References (26)

PMID Year Title