Property Summary

NCBI Gene PubMed Count 72
Grant Count 110
R01 Count 67
Funding $18,266,753.43
PubMed Score 0.00
PubTator Score 117.54

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P28067 Q29639 Q29640
Symbols DMA
HLADM
RING6
D6S222E

Gene

PDB

4FQX   4GBX   1HDM   2BC4  

Gene RIF (71)

PMID Text
26610428 pH-susceptibility of HLA-DO tunes DO/DM ratios to regulate HLA-DM catalytic activity.
25505276 study therefore reveals that HLA-DM polymorphic residues have a considerable impact on HLA-DM catalytic activity.
24904546 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
23260142 The structure of the HLA-DM-HLA-DR complex shows major rearrangements of the HLA-DR peptide-binding groove.
22860026 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22309257 DMA*01:01 (69.35%) and DMB*01:01 (52.5%) alleles were more frequent in Chinese Hans
22175768 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22103834 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22103833 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
21922073 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
More...

AA Sequence

MGHEQNQGAALLQMLPLLWLLPHSWAVPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFF      1 - 70
FDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFG     71 - 140
KPNTLVCFVSNLFPPMLTVNWHDHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDR    141 - 210
YTAIAYWVPRNALPSDLLENVLCGVAFGLGVLGIIVGIVLIIYFRKPCSGD                       211 - 261
//

Text Mined References (74)

PMID Year Title
26610428 2015 pH-susceptibility of HLA-DO tunes DO/DM ratios to regulate HLA-DM catalytic activity.
25505276 2015 HLA-DMA polymorphisms differentially affect MHC class II peptide loading.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23260142 2012 Crystal structure of the HLA-DM-HLA-DR1 complex defines mechanisms for rapid peptide selection.
22733780 2012 Mapping the HLA-DO/HLA-DM complex by FRET and mutagenesis.
22309257 2012 Analysis of HLA-DM polymorphisms in the Chinese Han population.
22247549 2012 Ubiquitination of human leukocyte antigen (HLA)-DM by different membrane-associated RING-CH (MARCH) protein family E3 ligases targets different endocytic pathways.
21131964 2011 HLA-DM captures partially empty HLA-DR molecules for catalyzed removal of peptide.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20408893 2010 DM influences the abundance of major histocompatibility complex class II alleles with low affinity for class II-associated invariant chain peptides via multiple mechanisms.
More...