Property Summary

NCBI Gene PubMed Count 72
PubMed Score 6.70
PubTator Score 117.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
active Crohn's disease 4.340 3.2e-05
active ulcerative colitis 3.578 3.0e-04
adrenocortical carcinoma -1.765 1.2e-02
adult high grade glioma 2.100 3.7e-03
astrocytoma 1.200 1.1e-07
Astrocytoma, Pilocytic 2.800 5.1e-09
colon cancer -1.800 2.1e-02
diabetes mellitus -1.400 3.3e-03
Down syndrome 1.100 1.0e-02
Duchenne muscular dystrophy 1.775 1.7e-09
ependymoma 1.800 5.2e-06
esophageal adenocarcinoma 2.200 1.8e-02
glioblastoma 1.700 1.5e-04
head and neck cancer and chronic obstruc... 1.300 3.0e-03
interstitial cystitis 2.000 3.2e-04
invasive ductal carcinoma 1.489 1.2e-03
juvenile dermatomyositis 1.309 4.7e-07
limb girdle muscular dystrophy 2A 1.119 4.5e-06
lung cancer -3.700 4.4e-05
lung carcinoma -3.000 1.6e-38
malignant mesothelioma -1.900 2.6e-06
nephrosclerosis 1.027 5.5e-04
non-small cell lung cancer -1.632 1.5e-11
osteosarcoma -1.402 2.0e-02
ovarian cancer -1.100 3.8e-02
pancreatic ductal adenocarcinoma liver m... 2.235 2.7e-02
subependymal giant cell astrocytoma 3.304 3.7e-03
tuberculosis and treatment for 3 months 1.100 3.9e-06
Waldenstrons macroglobulinemia 1.695 6.1e-03

Protein-protein Interaction (1)

Gene RIF (67)

AA Sequence

MGHEQNQGAALLQMLPLLWLLPHSWAVPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFF      1 - 70
FDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFG     71 - 140
KPNTLVCFVSNLFPPMLTVNWHDHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDR    141 - 210
YTAIAYWVPRNALPSDLLENVLCGVAFGLGVLGIIVGIVLIIYFRKPCSGD                       211 - 261
//

Text Mined References (74)

PMID Year Title