Property Summary

NCBI Gene PubMed Count 55
PubMed Score 8.10
PubTator Score 54.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
osteosarcoma 7950 1.5e-13
malignant mesothelioma 3232 3.6e-07
psoriasis 6694 4.6e-05
lung cancer 4740 2.3e-02
Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 4.0
Disease Target Count Z-score Confidence
Microcephaly 166 3.292 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer -1.200 2.3e-02
malignant mesothelioma -1.500 3.6e-07
osteosarcoma -4.201 1.5e-13
psoriasis -2.300 4.6e-05

Gene RIF (18)

AA Sequence

MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSEALEAARI      1 - 70
CANKYMVKSCGKDGFHIRVRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT     71 - 140
KLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGCGVKYIPNRGPLDKWR    141 - 210
ALHS                                                                      211 - 214
//

Text Mined References (60)

PMID Year Title