Property Summary

NCBI Gene PubMed Count 53
Grant Count 58
R01 Count 27
Funding $28,849,868.46
PubMed Score 108.78
PubTator Score 54.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -1.500 0.000
psoriasis -2.300 0.000
osteosarcoma -4.201 0.000
lung cancer -1.200 0.023

Synonym

Accession P27635 A3KQT0 D3DWW6 Q16470 Q2HXT7 Q53FH7 Q6FGN8 Q8TDA5
Symbols QM
L10
NOV
AUTSX5
DXS648
DXS648E

Gene

PDB

5AJ0   2PA2  

Gene RIF (20)

PMID Text
26290468 Our results expand the mutational and clinical spectrum of RPL10 identifying a new genetic cause of SED and highlight the emerging role of ribosomal proteins in the pathogenesis of neurodevelopmental disorders.
25846674 report confirms the implication of RPL10 mutations in neurodevelopmental disorders and extends the associated clinical spectrum from autism to syndromic intellectual disability
25316788 A mutation within the conserved N-terminal end of RPL10, a protein in close proximity to the peptidyl transferase active site of the 60S ribosomal subunit, causes severe defects in brain formation and function.
23263491 Mutations affect the ribosomal proteins RPL5 and RPL10 in 12 of 122 (9.8%) pediatric T-cell acute lymphoblastic leukemias, with recurrent alterations of Arg98 in RPL10.
23125841 Positional proteomics analysis identifies the cleavage of human 60S ribosomal protein L10 (RPL10) at amino acid residues 53-54 and 56-57 by the HIV-1 protease
23125841 Positional proteomics analysis identifies the cleavage of human 60S ribosomal protein L10 (RPL10) at amino acid residues 53-54 and 56-57 by the HIV-1 protease
23125841 Positional proteomics analysis identifies the cleavage of human 60S ribosomal protein L10 (RPL10) at amino acid residues 53-54 and 56-57 by the HIV-1 protease
23125841 Positional proteomics analysis identifies the cleavage of human 60S ribosomal protein L10 (RPL10) at amino acid residues 53-54 and 56-57 by the HIV-1 protease
22944692 Positional proteomics analysis identifies the cleavage of human 60S ribosomal protein L10 (RPL10) at amino acid residues 53-54 and 56-57 by the HIV-1 protease
21567917 mutation analysis of RPL10 in German patients with autism spectrum disorder
More...

AA Sequence

MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSEALEAARI      1 - 70
CANKYMVKSCGKDGFHIRVRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT     71 - 140
KLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGCGVKYIPNRGPLDKWR    141 - 210
ALHS                                                                      211 - 214
//

Text Mined References (56)

PMID Year Title
26290468 2015 A Novel Mutation in RPL10 (Ribosomal Protein L10) Causes X-Linked Intellectual Disability, Cerebellar Hypoplasia, and Spondylo-Epiphyseal Dysplasia.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25846674 2015 RPL10 mutation segregating in a family with X-linked syndromic Intellectual Disability.
25316788 2014 A novel ribosomopathy caused by dysfunction of RPL10 disrupts neurodevelopment and causes X-linked microcephaly in humans.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23263491 2013 Exome sequencing identifies mutation in CNOT3 and ribosomal genes RPL5 and RPL10 in T-cell acute lymphoblastic leukemia.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...