Property Summary

NCBI Gene PubMed Count 96
Grant Count 32
R01 Count 22
Funding $2,478,024.9
PubMed Score 120.01
PubTator Score 123.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -1.200 0.004
group 4 medulloblastoma 1.300 0.000
astrocytoma 1.500 0.006
medulloblastoma, large-cell 1.200 0.001
lung cancer 1.200 0.002
adult high grade glioma -1.100 0.001
ovarian cancer 1.400 0.000

Gene RIF (40)

PMID Text
26952537 The U2AF(65) linker residues between the dual RNA recognition motifs (RRMs) recognize the central nucleotide, whereas the N- and C-terminal RRM extensions recognize the 3' terminus and third nucleotide.
26687686 Serum RNU2-1f may serve as a biomarker for lung cancer detection, prognosis prediction and treatment monitoring.
26218986 Nuclear retention of full-length HTT RNA is mediated by splicing factors MBNL1 and U2AF65
26216990 U2AF(65) possesses a splicing Inhibitory function that leads to alternative exon skipping.
25605964 We demonstrated that PRPF40B interacts directly with SF1 and associates with U2AF(65
25422459 reduced U2AF(65) binding is a molecular consequence of disease-relevant mutations, and a structure-guided U2AF(65) variant is capable of manipulating gene expression in eukaryotic cells
25326705 U2AF has the capacity to directly define ~88% of functional 3' splice sites in the human genome; numerous U2AF binding events also occur in intronic locations.
24734879 The spatial distribution of U2AF65 conformations is found to be highly anisotropic, comprising significantly populated interdomain contacts that appear to be electrostatic in origin.
24389012 U2AF65 represents a new route for modulating TRF1 function at telomeres.
23376934 The results highlight both local and global conformational selection as a means for universal 3' splice site recognition by U2AF65.
More...

AA Sequence

MSDFDEFERQLNENKQERDKENRHRKRSHSRSRSRDRKRRSRSRDRRNRDQRSASRDRRRRSKPLTRGAK      1 - 70
EEHGGLIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVV     71 - 140
GSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQ    141 - 210
AMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLT    211 - 280
SFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLVSPPST    281 - 350
INQTPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRP    351 - 420
VDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW                   421 - 475
//

Text Mined References (111)

PMID Year Title
26952537 2016 An extended U2AF(65)-RNA-binding domain recognizes the 3' splice site signal.
26687686 2016 Circulating U2 small nuclear RNA fragments as a diagnostic and prognostic biomarker in lung cancer patients.
26420826 2015 Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.
26218986 2015 Nuclear retention of full-length HTT RNA is mediated by splicing factors MBNL1 and U2AF65.
26216990 2015 Splicing inhibition of U2AF65 leads to alternative exon skipping.
25605964 2015 Prp40 pre-mRNA processing factor 40 homolog B (PRPF40B) associates with SF1 and U2AF65 and modulates alternative pre-mRNA splicing in vivo.
25422459 2014 Structure-guided U2AF65 variant improves recognition and splicing of a defective pre-mRNA.
25416956 2014 A proteome-scale map of the human interactome network.
25326705 2014 Mechanisms for U2AF to define 3' splice sites and regulate alternative splicing in the human genome.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
More...