Property Summary

NCBI Gene PubMed Count 102
PubMed Score 127.82
PubTator Score 123.28

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.100 9.1e-04
astrocytoma 1.500 6.3e-03
group 4 medulloblastoma 1.300 1.3e-05
lung cancer 1.200 1.8e-03
medulloblastoma, large-cell 1.200 6.6e-04
ovarian cancer 1.400 2.1e-04
psoriasis -1.200 4.4e-03

PDB (26)

Gene RIF (45)

AA Sequence

MSDFDEFERQLNENKQERDKENRHRKRSHSRSRSRDRKRRSRSRDRRNRDQRSASRDRRRRSKPLTRGAK      1 - 70
EEHGGLIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVV     71 - 140
GSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQ    141 - 210
AMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLT    211 - 280
SFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLVSPPST    281 - 350
INQTPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRP    351 - 420
VDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW                   421 - 475
//

Text Mined References (119)

PMID Year Title