Property Summary

NCBI Gene PubMed Count 96
PubMed Score 120.01
PubTator Score 123.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
group 4 medulloblastoma 1875 1.25198375908873E-5
ovarian cancer 8492 2.10720399780127E-4
medulloblastoma, large-cell 6234 6.62727473687335E-4
adult high grade glioma 2148 9.14799475613147E-4
lung cancer 4473 0.00175550209031485
psoriasis 6685 0.0044397212291965
astrocytoma 1493 0.00629896809920852

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -1.200 0.004
group 4 medulloblastoma 1.300 0.000
astrocytoma 1.500 0.006
medulloblastoma, large-cell 1.200 0.001
lung cancer 1.200 0.002
adult high grade glioma -1.100 0.001
ovarian cancer 1.400 0.000

Synonym

Accession P26368 Q96HC5
Symbols U2AF65

Gene

PDB

1JMT   1O0P   1OPI   1U2F   2G4B   2HZC   2M0G   2U2F   2YH0   2YH1   3VAF   3VAG   3VAH   3VAI   3VAJ   3VAK   3VAL   3VAM   4FXW   4TU7   4TU8   4TU9   5EV1   5EV2   5EV3   5EV4  

  Ortholog (13)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG
Zebrafish OMA Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (40)

PMID Text
26952537 The U2AF(65) linker residues between the dual RNA recognition motifs (RRMs) recognize the central nucleotide, whereas the N- and C-terminal RRM extensions recognize the 3' terminus and third nucleotide.
26687686 Serum RNU2-1f may serve as a biomarker for lung cancer detection, prognosis prediction and treatment monitoring.
26218986 Nuclear retention of full-length HTT RNA is mediated by splicing factors MBNL1 and U2AF65
26216990 U2AF(65) possesses a splicing Inhibitory function that leads to alternative exon skipping.
25605964 We demonstrated that PRPF40B interacts directly with SF1 and associates with U2AF(65
25422459 reduced U2AF(65) binding is a molecular consequence of disease-relevant mutations, and a structure-guided U2AF(65) variant is capable of manipulating gene expression in eukaryotic cells
25326705 U2AF has the capacity to directly define ~88% of functional 3' splice sites in the human genome; numerous U2AF binding events also occur in intronic locations.
24734879 The spatial distribution of U2AF65 conformations is found to be highly anisotropic, comprising significantly populated interdomain contacts that appear to be electrostatic in origin.
24389012 U2AF65 represents a new route for modulating TRF1 function at telomeres.
23376934 The results highlight both local and global conformational selection as a means for universal 3' splice site recognition by U2AF65.
More...

AA Sequence

MSDFDEFERQLNENKQERDKENRHRKRSHSRSRSRDRKRRSRSRDRRNRDQRSASRDRRRRSKPLTRGAK      1 - 70
EEHGGLIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVV     71 - 140
GSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQ    141 - 210
AMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLT    211 - 280
SFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLVSPPST    281 - 350
INQTPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRP    351 - 420
VDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW                   421 - 475
//

Text Mined References (111)

PMID Year Title
26952537 2016 An extended U2AF(65)-RNA-binding domain recognizes the 3' splice site signal.
26687686 2016 Circulating U2 small nuclear RNA fragments as a diagnostic and prognostic biomarker in lung cancer patients.
26420826 2015 Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.
26218986 2015 Nuclear retention of full-length HTT RNA is mediated by splicing factors MBNL1 and U2AF65.
26216990 2015 Splicing inhibition of U2AF65 leads to alternative exon skipping.
25605964 2015 Prp40 pre-mRNA processing factor 40 homolog B (PRPF40B) associates with SF1 and U2AF65 and modulates alternative pre-mRNA splicing in vivo.
25422459 2014 Structure-guided U2AF65 variant improves recognition and splicing of a defective pre-mRNA.
25416956 2014 A proteome-scale map of the human interactome network.
25326705 2014 Mechanisms for U2AF to define 3' splice sites and regulate alternative splicing in the human genome.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
More...